Conserved Protein Domain Family
Med13_C

?
pfam06333: Med13_C 
Mediator complex subunit 13 C-terminal
Mediator is a large complex of up to 33 proteins that is conserved from plants through fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function. Med13 is part of the ancillary kinase module, together with Med12, CDK8 and CycC, which in yeast is implicated in transcriptional repression, though most of this activity is likely attributable to the CDK8 kinase. The large Med12 and Med13 proteins are required for specific developmental processes in Drosophila, zebrafish, and Caenorhabditis elegans but their biochemical functions are not understood.
Statistics
?
PSSM-Id: 399381
Aligned: 89 rows
Threshold Bit Score: 184.013
Threshold Setting Gi: 1024075948
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EHA19620     1052 CAPPVLLAEPiprSIGFKLSSEGSSPL-QEGKHLHIACSRSLDQrWLSVAWSDNFGALQRNMSYCLRYRNSVAARPLPEV 1130 Aspergillus n...
XP_013342529 1072 PSPSIHLATPqsrKVNFTLSDRIPKTLlEEAGILHVAYAVNADHsWLSAAWTDNTGNQSYKAAYCL------SNTDGRLI 1145 Aureobasidium...
XP_013428683 1054 TCPSIHLGTPpsrKINFALTDRVSRNLlEEASILHVAYAVNADNsWLSAAWTDNTGTHCHKASYCL------SNTDGRII 1127 Aureobasidium...
KEQ61306     1080 LSPCIHLASPpsrKINFALTERTPKNLlEEAQILHVAYAVNADNsWLSAAWTDNTGIHYHKASYCL------SNTDGRII 1153 Aureobasidium...
EMC99515     1077 AAPFVELACPppkRIGFQLVAEPPGDLlHEGSALHLAYAVSADGkWMTVAWTDSSGRNQSNSSFCL------CGRTFANV 1150 Baudoinia pan...
XP_003852955 1298 AAPSVELANAapkRIAFQLAAEPPSDLlHEGSILHLAYACSQDGhWLTVAWIDNTGQHQSTASFCL------RGKTFSEV 1371 Zymoseptoria ...
EME49679     1095 SAPSIELASAapkRIGFQLAAEPPSHLlHEGSVLHLAYACSKDWqWVTAAWGDNTGLYQSSVTYSL------RGKSLAEV 1168 Dothistroma s...
KXT14673     1118 SAPSVELVSAapkRIGFQLAAEPPTDLlHEGSILHIAYSVSKDGqWMSVCWIDNTGRHQSSTAFCL------RGRSLAEV 1191 Pseudocercosp...
EMF16317      772 AAPTVELASTapkRLGFQLASEAPGDLlYEGSILHLAYAHSSDGmWLTACWIDSTGKHQSSSSFGL------AGRTFAEV 845  Sphaerulina m...
XP_007761462 1051 CGSAVVLSRSe-nTVRLQLSPTYVSPLeKNGPCLHLAYSMSLDKkWLAAAWTDELGHTALSMSYCSHVHKSGRRRPRQEI 1129 Cladophialoph...
EHA19620     1131 RGEIWKATRDIMDTIQTRWKIIIVSTDP-VDQDEVDTWTNFADQYGKARsTTLDLAILGANIPSDLHLEPPYLPIPlSMF 1209 Aspergillus n...
XP_013342529 1146 LTEVRDTTLSLAG--NSPHRIFVARAGI-MRDWEKRIWRERPS-------ENWSIALLDVDVNPALQVC--ANPESnGGL 1213 Aureobasidium...
XP_013428683 1128 LTEVRDTTLSLCR-NN-PHRILVARAGV-MRDWEKRVWRERPG-------ESWSIGLLDVDVSPALQVS--ANTEGnNGP 1195 Aureobasidium...
KEQ61306     1154 LTEVRDTTLSLAR--DSPHRVFVARAGV-MRDWEKRIWREKPS-------ENWSIALLDVDMSPALQIG--ANTDGgGVL 1221 Aureobasidium...
EMC99515     1151 LVDIWERTRGIMAAREATWRVFVVTDGP-IDDSISRCWRQTVQSPRKQA---FSVTLLSAKLDMGLQLTPHFLTTG-DTT 1225 Baudoinia pan...
XP_003852955 1372 AEDVWGRTREILAARQVTWRVFIVTPDA-MDTSLSQCWRSITSRRRPHP---LCVTLLSVQLDPILHLSPPAPPSD-TQI 1446 Zymoseptoria ...
EME49679     1169 AEEVWERTYEILAARKVTWRLFIVTHQG-LDQSMSQCWRSLSKpraq----plcVTLSSVQLDPVLVADSPASPEA-QLK 1242 Dothistroma s...
KXT14673     1192 IEDVWECTRDILAARQVLWRIFIVTTDA-IEKSVLQCWRSFSAKPRTQA---ICVTLLTIDTDPVLQLSPPVANVD-SQF 1266 Pseudocercosp...
EMF16317      846 AHDVWEFTRTIMAARQVSWRVFIVAPGAdLDPSAVQCWRSVAARPRSHP---VCVTLLSTQEDPFLQLY--RPCES-SCY 919  Sphaerulina m...
XP_007761462 1130 LKEMWEVSHDLMSKVRGAWRLAVVRHGY-FEPAELLEWQRIVDVSPTPQ-KQCLLLLLSIQLQPELAVFPPPPHGK-PTL 1206 Cladophialoph...
EHA19620     1210 N----QQPS------STPVAT-PNLggG----VSSPDQFGt-----APTPPGGWGGPASAST----PTDALPEV--ESES 1263 Aspergillus n...
XP_013342529 1214 G-----NPF------MTPAAT-PQAstFtspeTGPQPSTP------AEATPSTQQEILQAP-----HPPPPPDP--DADA 1268 Aureobasidium...
XP_013428683 1196 G----GQGL------WTPAAT-PQAs-----tFTSPEGVDt----kPSTPVETPNSAANLNTq---QELQQQQI--DPEA 1250 Aureobasidium...
KEQ61306     1222 G----MGAF------MTPAAT-PQAs------TFTSPETG------DTKPSTPAGETPTQQQ----ELSSLQQA--DPDA 1272 Aureobasidium...
EMC99515     1226 G----TVAA------TTTGFLtPGStpQaaltTVSPEAAT------HAAPPTPAPSD---------AAVASAEP--DPDA 1278 Baudoinia pan...
XP_003852955 1447 TwptaDGGF------LTPAST-PQAgn----lTSSPNPGG------DSTAPPTPAPSETM------TAASIAEN--DPDA 1501 Zymoseptoria ...
EME49679     1243 Dns-qDGGF------LTPAST-PQGn------NFTSSPDVsgqsnaPATPAPSDTPASALEM--------------ETET 1294 Dothistroma s...
KXT14673     1267 E----SRSDgg---fLTPAST-PQAg------TFTSSPDV------NGQGGNAPPTPAPSE-----TAASAPEN--DPDA 1319 Pseudocercosp...
EMF16317      920 Gg---GGGSnaevgvLTPAST-PQGa------TFTSSPDV------SGHTSNAPPTPAASETanslPTDGTG----DSDA 979  Sphaerulina m...
XP_007761462 1207 Sg--aHNQY------GTPVST-PQAs------ITSPDQAV------PATPTPGGSSFMNPST----PSDPGFDPntESDL 1261 Cladophialoph...
EHA19620     1264 LLTDIYDETWGVVLSh--RLNSSPHQTE---YRPALASGYLLRRK-------GSTD-GDGLYT---MSVNILFARRS-PS 1326 Aspergillus n...
XP_013342529 1269 FLMDITDETYTLLLP----FSCTKNTm----LQRPLACSLLL----------KRGD-GDGVANlpaLAVDLMDVMPPrIP 1329 Aureobasidium...
XP_013428683 1251 FLIDNTDETWGVLMP----FSCTRATT----LSRPLASGLLLKRG-------AHDS-TANLPS---VAIDLMDVIPPrIS 1311 Aureobasidium...
KEQ61306     1273 FLIDNTDETWGVLMP----FSCTRSTt----LSRPLASGLLLKRG-------PSDS-LSNLPS---LAVDLMDVIPPrIP 1333 Aureobasidium...
EMC99515     1279 HFVDLADETWAVVFSqpnFLPSSPVSTTptpSVNGLAQGALFKRGeag--ldGVGVpGDHLPS---LGVTLLWTVQV-RP 1352 Baudoinia pan...
XP_003852955 1502 YLTDLTDETWGVLLSp--KLAPFASS------FPGQANGALFRRG-------DPSP-GEALPS---LGVSVHWTIQV-KP 1561 Zymoseptoria ...
EME49679     1295 HLVDVTDETWGVLIS-----PNFSSL-I---VDVGLANALIFKRGeaa-aasSDGS-RRSLPG---MGVTLHWTIQV-KP 1359 Dothistroma s...
KXT14673     1320 HLTDLTDETWGVLLSp--RLNNVGSNVG-------LANGVLFKRGnia-vpeGEGTaADKLRS---IGISIHWTIQV-KP 1385 Pseudocercosp...
EMF16317      980 HLMDMTDETWGVLLSt--KLLSDHHASS----SSRMAHGVLFQRGpasmpdsEHTDtGDKLPS---LGVNLHWTIQV-KS 1049 Sphaerulina m...
XP_007761462 1262 TIVDPSEESWGIILPy--GINQSRSMTE---LRPSQVTGFLMKRR-------GPRG-EDGYNM---IEISLLKSITQtsn 1325 Cladophialoph...
EHA19620     1327 SY----------DALLreILGMYRDLATLARARGT-RTVQQg-----------TLPWHVATA 1366 Aspergillus niger ATCC 1015
XP_013342529 1330 EGqvswltqrapETVLreTMLAFRGLGLLGRVRGV-PGCDKg-----------NVPWHLGVA 1379 Aureobasidium subglaciale EXF-2481
XP_013428683 1312 DTgvnwlgfrapETVLkeCMVWYRGLGLLGKLRGV-GGCKEgvn------gngSVPWHLGVA 1366 Aureobasidium namibiae CBS 147.97
KEQ61306     1334 ENavswlaqrapETTLkeTMVWYRGLGLLGKLRGV-GECEEg-----------NVPWHLGVV 1383 Aureobasidium melanogenum CBS 1...
EMC99515     1353 SGsvdeggakqaEMALreMLKLYRHLSVLTRARGL-GDDGVggsgdgngnadaCVPFHLVAA 1413 Baudoinia panamericana UAMH 10762
XP_003852955 1562 SGgvddgsvkqaELTCreVLKMYRGLSVLTKARGL-DGGRRgt--------ewVTPVHVAMV 1614 Zymoseptoria tritici IPO323
EME49679     1360 NGaidegsvkqaELTLreLVKMYRNLALLTKAKGLdRGKAV------------CAPLPVAAA 1409 Dothistroma septosporum NZE10
KXT14673     1386 SGgvdegsvkqaELTLreVLRMYRNLALLTKARAIaHGKMG------------FVPIHVAAA 1435 Pseudocercospora musae
EMF16317     1050 QGgvdegsakqaELTLrdVLRMYRGLTTLTNARSL-IRSAAaaag----tgksILPVHVAMA 1106 Sphaerulina musiva SO2202
XP_007761462 1326 kp-----nevmpDDLLddVIRQYRGLVTLGASRGC-VDPSRe-----------CLPWHIATA 1370 Cladophialophora yegresii CBS 1...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap