Conserved Protein Domain Family
Phage_antiter_Q

?
pfam06323: Phage_antiter_Q 
Phage antitermination protein Q
This family consists of several phage antitermination protein Q and related bacterial sequences. Phage 82 gene Q encodes a phage-specific positive regulator of late gene expression, thought, by analogy to the corresponding gene of phage lambda, to be a transcription antiterminator.
Statistics
?
PSSM-Id: 399376
Aligned: 5 rows
Threshold Bit Score: 320.98
Threshold Setting Gi: 75078299
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q37965         2 ELNSIRACVSTALSDIHYLQRGILeVQLEQLRLASSDRFTDKPTRTicigDTESYEISVPAEPVRYHVGKSFKRSSMLLT 81  Escherichia vir...
CBJ81113       8 DLQYVRSQIIPALFDIAGETKGQL-AAFEDSPLTCTDHYKRNKARI----RVGNHWVVQDTDPVFCLETRMRKQPKPPIN 82  Xenorhabdus bov...
Q2NSF5         2 NIEWVRGRIRYALADIRQIRNGQL-VNLAERTRVETSRFNRNPPRFf--cHANGSTIRVPSSPVKAKQTRVKGKAIIPIH 78  Sodalis glossin...
WP_012132744   3 NLSYIRQQLIAATVDLSGATKGQL-MAWLENAQFDTNTYPRKRLRVr--dEVTGKLITLNNPPIPGKQSHAKGSHIPLVQ 79  Citrobacter koseri
Q8ZMY5         5 YLQYVREQLMVATADLSGETKGQL-LAWLENAQFDTKNYPRKKQRIw--dEETESWITLNNPPIPGKQSLAKGSAIPLVK 81  Salmonella ente...
Q37965        82 ELDFMTASWRRAIEQLNSEETAWLHYCYGCKPNYKNDVTVCQWLWMDFLiahSRAGFKKMKAPTKKIMQRLTYYGIQQVK 161 Escherichia vir...
CBJ81113      83 PITYRGSSWRRAVLAMDKPKLAWVLYCYAHSLDYRYQVEICEYLWGGFL---AGQTNRRLSIKVSTRLKGLVWLAVQQRA 159 Xenorhabdus bov...
Q2NSF5        79 EYDYSLVPWRRAIGGLDEPLQAWIRYCYGDYRHHAEQLNVVPYVWQKFM---AQQPG-RISGKVRQRLQGLALLAVQVVA 154 Sodalis glossin...
WP_012132744  80 PVEYSTASWRRALMSLDEHQKAWLLWNYSESTCWDHQVIITRWAWEQFS---KQMGGKRVAKKTIERLRQLIWLAAQDMK 156 Citrobacter koseri
Q8ZMY5        82 PVEYSTASWRRAVLSLDEHYKAWLLWNYSENTCWEHQVEITQWGWSAFA---AQLDGKKMAGKTQERLRALIWLAAQDVK 158 Salmonella ente...
Q37965       162 ceifHELHDSDIDgMERDEhISSLVGVSVESWRKDYKKRWLLLKSRCMHLNDTALLNAAEKRCEIIESH 230 Escherichia virus N15
CBJ81113     160 ----KGCRSENFLsYTRSE-LASLTGVSLYNWKNNYAAHWIALVELCENMDREALQDIIRLRIKQKSDH 223 Xenorhabdus bovienii SS-2004
Q2NSF5       155 ----REIDGRPKR-YTYAE-LADMVGVKKQNWNEVYKHYWHGLIEATFCLDLAALKCVDNVMLLQKPGS 217 Sodalis glossinidius str. ...
WP_012132744 157 ----SALAGREQ--YQYAD-LAALVGVEDKNWSKTFTAHWLGMLRLFAELDRESLLSLTKTRSQQKATN 218 Citrobacter koseri
Q8ZMY5       159 ----SELAGREV--YQYKE-LAGLVGVSEKNWSETFTRHWLTMRAIFLRLDQASLLSVSESRSEQVAFN 220 Salmonella enterica subsp....
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap