Conserved Protein Domain Family
Ail_Lom

?
pfam06316: Ail_Lom 
Enterobacterial Ail/Lom protein
This family consists of several bacterial and phage Ail/Lom-like proteins. The Yersinia enterocolitica Ail protein is a known virulence factor. Proteins in this family are predicted to consist of eight transmembrane beta-sheets and four cell surface-exposed loops. It is thought that Ail directly promotes invasion and loop 2 contains an active site, perhaps a receptor-binding domain. The phage protein Lom is expressed during lysogeny, and encode host-cell envelope proteins. Lom is found in the bacterial outer membrane, and is homologous to virulence proteins of two other enterobacterial genera. It has been suggested that lysogeny may generally have a role in bacterial survival in animal hosts, and perhaps in pathogenesis.
Statistics
?
PSSM-Id: 115004
View PSSM: pfam06316
Aligned: 2 rows
Threshold Bit Score: 409.448
Threshold Setting Gi: 447155885
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9LA63         1 MRKLCAVILSAVVWLVAAGTPASAAEHQSTLSAGYLQTHTDMPGSDDLNGINVKYRYEFTDTLGLITSFSYANAEGEQKT 80  Enterobacterial...
WP_001233141   1 MRKVCAAILSAAICLAVSGVPAWASEHQSTLSAGYLHASTDAPGSDDLNGINVKYRYEFTDTLGLITSFSYANAEDEQKT 80  Escherichia coli
Q9LA63        81 HYNDTRWHEDSVRNRWFSVMAGPSVRVNEWFSAYALAGVSYARVSSFAGDYVTLTSDEGKKQEHLTRSDSGRRSHTALTY 160 Enterobacterial...
WP_001233141  81 HYSDTRWHEDYVRNRWFSVMAGPSVRVNEWFSAYAMAGVAYSRVSTFSGDYFRVTDNKRKTHDVLTGSDDARYSNTSLAW 160 Escherichia coli
Q9LA63       161 SAGVQINPTENIVVDLAYEASGRGDWRTEAFIVGTGYRF 199 Enterobacterial phage P-EibA
WP_001233141 161 GAGVQFNPTESVAVDVAYEGSGSGDWRTDGFIVGVGYKF 199 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap