Conserved Protein Domain Family
CgtA

?
pfam06306: CgtA 
Beta-1,4-N-acetylgalactosaminyltransferase (CgtA)
This family consists of several beta-1,4-N-acetylgalactosaminyltransferase proteins from Campylobacter jejuni.
Statistics
?
PSSM-Id: 114995
View PSSM: pfam06306
Aligned: 2 rows
Threshold Bit Score: 620.126
Threshold Setting Gi: 75408568
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9LAK4   1 MLFQSYFVKIICLFIPFRKIRHKIKKTFLLKNIQRDKIDSYLPKKTLVQINKYNNEDLIKLNKAIIGEGHKGYFNYDEKS 80  Campylobacter jejuni
Q93MQ2   1 MLFQSYFVKIICLFIPFRKIRHKIKKTFLLKNIQRDKIDSYLPKKTLIQINKYNNEDLIKLNKAIIGGGHKGYFNYDEKS 80  Campylobacter jejuni
Q9LAK4  81 KDPKSPLNPWAFIRVKNEAITLKASLESILPAIQRGVIGYNDCTDGSEEIILEFCKQYPSFIPIKYPYEIQIQNPKSEEN 160 Campylobacter jejuni
Q93MQ2  81 KDPKSPLNPWAFIRVKNEAITLKASLESILPAIQRGVIGYNDCTDGSEEIILEFCKQYPSFIPIKYPYEIQIQNPKSEEN 160 Campylobacter jejuni
Q9LAK4 161 KLYSYYNYVASFIPKDEWLIKIDVDHIYDAKKLYKSFYIPKNKYDVVSYSRVDIHYFNDNFFLCKDNNGNILKEPGDCLL 240 Campylobacter jejuni
Q93MQ2 161 KLYSYYNYVASFIPKDEWLIKIDVDHYYDAKKLYKSFYIPRKNYHVISYSRIDFIFNEEKFYVYRNKEGEILKAPGDCLA 240 Campylobacter jejuni
Q9LAK4 241 INNYNLKWKEVLIDriNNNWKKATKQSFSSNIHSLEQLKYKHRILFHTELNNYHFPFLKKHRAQDIYKYNWISIEEFKKF 320 Campylobacter jejuni
Q93MQ2 241 IQNTNLFWKEILIE--DDTFKWNTAKNNIENAKSYEILKVRNRIYFTTELNNYHFPFIKNYRKNDYKQLNWVSLDDFIKN 318 Campylobacter jejuni
Q9LAK4 321 YLQNINHKIEPSMISKETLKKIFLTLF 347 Campylobacter jejuni
Q93MQ2 319 YKEKLKNQIDFKMLEYKTLKKVYKKLT 345 Campylobacter jejuni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap