Conserved Protein Domain Family
Lambda_Kil

?
pfam06301: Lambda_Kil 
Bacteriophage lambda Kil protein
This family consists of several Bacteriophage lambda Kil protein like sequences from both phages and bacteria. Induction of a lambda prophage causes the death of the host cell even in the absence of phage replication and lytic functions due to expression of the lambda kil gene.
Statistics
?
PSSM-Id: 399363
Aligned: 2 rows
Threshold Bit Score: 83.1857
Threshold Setting Gi: 138622
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P03758 43 MDQTLMAIQTKFTIATFIGDEKMFREAVDAYKKWILILKLRS 84  Escherichia virus Lambda
P03758 43 MDQTLMAIQTKFTIATFIGDEKMFREAVDAYKKWILILKLRS 84  Escherichia virus Lambda
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap