5KAI


Conserved Protein Domain Family
PsbY

?
pfam06298: PsbY 
Click on image for an interactive view with Cn3D
Photosystem II protein Y (PsbY)
This family consists of several bacterial and plant photosystem II protein Y (PsbY) sequences. PsbY is a manganese-binding protein that has an L-arginine metabolising enzyme activity.
Statistics
?
PSSM-Id: 399361
Aligned: 45 rows
Threshold Bit Score: 29.9056
Threshold Setting Gi: 497453428
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5KAI_R              1 MDWRVLVVLLPVLLAAGWAVRNILPYAVKQVQKLL 35  Thermosynechococcus elongatus BP-1
XP_009406386       88 gDNRGLALLIPLVPAVLWVLYNILQPALNQLNRMr 122 wild Malaysian banana
EEF47588           85 gDNRGLALLLPIIPALGWVLFNILRPALNQINRMr 119 castor bean
EFH64877           76 sDNRGLALLLPIIPAIAWVLYNILQPAINQVNKMr 110 Arabidopsis lyrata subsp. lyrata
jgi:Pse7367_2502    1 MDLRVLIVLGPIVLVIGWAAFNILTAAAKGEAKLF 35  Pseudanabaena sp. PCC 7367
jgi:Syn7502_03039   3 aDLRPLLVLAPIGLVVVWAAYNMTKAVLKGEAKLF 37  Synechococcus sp. PCC 7502
jgi:Cyagr_0891      1 MDLRLLLVAAPILLAVGWAAFNIGRAAVGQLQLML 35  Cyanobium gracile PCC 6307
XP_024363477       92 gDNRVVALLIPLVPAIGWVLFNILKPALNQVDKMk 126 Physcomitrella patens
XP_024532492       89 sDSRGLALLVPLVPAVGWVLFNILRPGLNQFERMk 123 Selaginella moellendorffii
XP_024532492      237 sDNRGLLLLLVILPAIGWVLFNILKPALNQLNNMk 271 Selaginella moellendorffii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap