Conserved Protein Domain Family
PET

?
pfam06297: PET 
PET Domain
This domain is suggested to be involved in protein-protein interactions. The family is found in conjunction with pfam00412.
Statistics
?
PSSM-Id: 399360
Aligned: 36 rows
Threshold Bit Score: 110.409
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EKC35011      33 EEYAWVPPGLKPEQVHQYFSCLPEDKVPF---LNSVGEKYRVRQLLQQLPPHDNEVRYCNTL-TEEEKRELRMFSVQRKR 108 Pacific oyster
XP_007251547 111 ITYDWAPPGLTQKLAMQYMEFLPEERRPV---AGTEGALYRRRQLMRQLPAYDQDPSHCHSL-SEAELKAMAQFVKSYKE 186 Mexican tetra
XP_005942836 116 TTYDWAPAGLNQKLAMQYMELLPESQRPV---SGTVGALERRRQLLIQLPAYDQDPMKCQSLaSEEEISSMLLFVKQYKQ 192 Burton's mouthb...
6_pfamImport   1 VTYEWAPPGLTQKLGLGIL-VCPGEGMGLlggTGNPGLSRRARRVQHQLPLHDQDPAQCRGL-GEGEQPLMEEFVRRYKA 78 
XP_004738481 116 ITYEWAPPGVTQKLGLQYMELIPKEKQPV---TGTEGAYYRRRQLMHQLPIYDQDPSRCRGL-LENEVKVMEDFVKQYKS 191 domestic ferret
XP_010717072 120 ITYEWAPPGLTQKLAMQYMELIPKEMQPV---AGTDGAHYRRRQLVRQLPVHDHDPSQCRGL-AEGEAKLMEDFVKKYKA 195 turkey
4_pfamImport   1 ATYEWTPQASDPKLVDSYVSALPKDKQPI---VGSAGAKYRKKQLMRQLPSHDQEPNECHDL-TPQETTEMSLFVKQYRE 76 
XP_008213365 104 TPFEWIPPDTTKELAADYMKALPSDKMPI---KGSSGAALRRLQLQKQLPLHDIDHKACDTL-TDKERKEFEKYLDNLKN 179 jewel wasp
XP_001949083 119 FKFDWVPPNVHKDLASEYMQLLPSDKLPI---SGSEGAFYRRKQLEKQVPLHDFNANVCHNL-TIEEADAMGSYLKNLKE 194 pea aphid
NP_001096323 111 VTYEWAPPGLNQKLAMQYMELIPKNMQPV---AGTEGAHYRRVQLLRQLPPYDHNPDLCQGL-SERERTAMEDFVKRYKE 186 tropical clawed...
EKC35011     109 EALGR-GSVR 117 Pacific oyster
XP_007251547 187 EALGV-GEVA 195 Mexican tetra
XP_005942836 193 EVLGV-GEVA 201 Burton's mouthbrooder
6_pfamImport  79 EALGVgGEVA 88 
XP_004738481 192 EALGV-GEVA 200 domestic ferret
XP_010717072 196 EALGV-GEVA 204 turkey
4_pfamImport  77 KALGV-ARVE 85 
XP_008213365 180 CA-GQ-GKVT 187 jewel wasp
XP_001949083 195 NAVGQ-GLVK 203 pea aphid
NP_001096323 187 QALGV-AEVA 195 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap