Conserved Protein Domain Family
DUF1043

?
pfam06295: DUF1043 
Protein of unknown function (DUF1043)
This family consists of several hypothetical bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 399358
Aligned: 34 rows
Threshold Bit Score: 80.0137
Threshold Setting Gi: 503873921
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q47W28             6 ALVIFIIGGIGGFFANRLLSST-SQEQRKLADQVNKSEAALDQYKLDVAEHLDSSAKLLDQMNNTCQTAMKQMKESTQLL 84  Colwellia p...
Q7VQR8             7 IFISLLMGIIIGITGMYYKNRNlLNNQKNLYNELQHNKTKLNEYQKKLSTHFSYNIEILNKISKNYQDLYQNITKNANFF 86  Candidatus ...
Q8D359             5 VFIGFILGLIIGLIIMRYGNKT-IRNQNKIKKNLEESKEEFIEYKKEIKDHLFKSMELLEKLTSDYHNLYNHIYKGYKFF 83  Wiggleswort...
WP_014995886       7 nLISFVVGLVLGAGLLYWLLPA-RRQSSRVLRDRDDARQALNHYRDQVDHHFLRTAELVNELTNAYRAVHQQLSEGASEL 85  Alcanivorax
Q2SBK0             8 AAVTFLVGLGLGVLLHKLLHSE-TAKNRRLERQIDHLQDQHTRYQAEVAEHFSRTAEMLGKLNANYRDIFNHLAVGAERL 86  Hahella che...
Q9CMW5            12 AGIGLVIGLILGYLFLRLTKGS-VKKQLQTETELQKVKNQLDNQKQQLEKHFSESAELLKNIAQDYQKLYKHLATSSTTL 90  Pasteurella...
jgi:HSM_1284      12 ALIGLCIGVFIGYLLLRFTKGT-VKKQIKTEAELEQVKIQLNNQKRQLEQHFAESAELLKNIAQDYQKLYLHLANSSTTL 90  Histophilus...
Q5R0J2             6 gvllVVAGAIIGFFAARYSQSK--GQSGDLEEQVQQSQQRLTDYQREVAEHFATANAMVEQLADTQQRLQSYLNQSAELL 83  Idiomarina ...
Q3IG23            10 VIIVAIAAFFIGAFVTKK-----QFKHDELEEQVEQAKNTLEQYRQDVADHLANTGKLVTKMKDNYDQLLSHVEETNQLL 84  Pseudoalter...
chanu:ambt_14525   6 slalLVVGLIIGFFIGRFVQTK--TGGNSAAQTEQQVKEILAQQAQH---HIHQTRQSLEGIESQCETLKQQIEEYEALL 80  Alteromonas...
Q47W28            85 qkattveaegmpFFsAETQQQLAQTATLRHQKRASEAvEAMTEAPLDYSGNPSGLFAD 142 Colwellia psychrerythraea 34H
Q7VQR8            87 ------------LPnTYTQHDTYYTHHINNTQNNHTE-PLPIETPKDYSDNPEHNILK 131 Candidatus Blochmannia floridanus
Q8D359            84 ---------------------IYKKSKKNYIKNENEF-FFEKTQPRDYPIKNDKIILN 119 Wigglesworthia glossinidia endosy...
WP_014995886      86 cseagrqraaakSLdAAGEQNMPV------------------SQPLDYAPKAKGTLAE 125 Alcanivorax
Q2SBK0            87 csdsefkslvssATpSLSVKRKEGKSKVEE--------ESVFEPPRDYAPKADpkekg 136 Hahella chejuensis KCTC 2396
Q9CMW5            91 ------------LP-ELTNKPLFSSHLITTEHVDRHDqRNKDDHRRDYCEGSSGLLRN 135 Pasteurella multocida
jgi:HSM_1284      91 ------------LP-ELAQKELFSPHLLATESISSQQdKSKDNQPRDYSEGSSGILKA 135 Histophilus somni 2336
Q5R0J2            84 eksdv--qsdlpFFaEDTIKQLRVANSLNKDHRSGRDsYSANDIPRDYTEGSSGLFSS 139 Idiomarina loihiensis
Q3IG23            85 ledrnkapaepfFSkEMTEQLQASLKERRSDR------SNADAQPADYVSGESGLFAG 136 Pseudoalteromonas haloplanktis TA...
chanu:ambt_14525  81 tqssd--dedakVPfYGEQATSYLRNNLKSSEKSKVN-KVSDTQPKDFANSGSGLFVG 135 Alteromonas naphthalenivorans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap