2KO6


Conserved Protein Domain Family
DUF1040

?
pfam06288: DUF1040 
Protein of unknown function (DUF1040)
This family consists of several bacterial YihD proteins of unknown function.
Statistics
?
PSSM-Id: 399351
Aligned: 16 rows
Threshold Bit Score: 119.752
Threshold Setting Gi: 491997499
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2KO6_A             1 MKCKRLNEVIELLQPAWQKEPDFNLLQFLQKLAKESGFDGELADLTDDILIYHLKMRDSAKDAVIPGLQKDYEEDFKTAL 80 
WP_015699259       1 MKEHRVNELIELLHPAWKEDCDLNLLEFIQKLATECGYQGPLGELSDDTLIYHLKMRGTDSTTEIPGLKKDYEDDFKTAI 80  Rahnella aq...
P44900             1 MKCKRLNEVLELLQSYWSKDSDLSLMEILQKIANESGFQKPLNELTDEVIIYQLKMDGTDKYEPIPGLKKDYEEDFKTAL 80  Haemophilus...
WP_005713307       1 MKCKRLDEVLELLGEHWRKEPDLHLLDLLHKLAEEVGKPNDLDALRDEVLIYQLKMRGKDKTEVIPGIKKDYEEDFKTAL 80  Pasteurella...
tigr:AHA_4219      1 MQCHRIEELLELLQPAWIKEQDLSLVQFVAKLAEEAGFEGPLSELTDDMLIYHLKMRESDKQAMIPGLAKDHVPDFKEAL 80  Aeromonas h...
jgi:Tola_2973      1 MQCHRIEELLELLQDEWLKEQDLNLLQFLQKIATEAGYAEPLQSISDDTLIYQLKMRSRGESEMIPGLAKDVVPDFKEAL 80  Tolumonas a...
UNSW:PCNPT3_12870  1 MHTHRINELLELLQPYWLKNKELSLLEVLDLIRKEAAFEQPVEKLTDEVLIYHLKMAQIGKDEMIPGIKKDFEDDFKNAL 80  Psychromona...
Q87KC6             1 MKCHRIEELLELLEPEWQKDQEMNLLQFIVKLAQEAGYDGKLEDLSDDVLIYHLKMRNSSKDEMIPGLKKDQEDDFKTAI 80  Vibrio para...
Q5E1Q1             1 MKCHRVNELIELIHPEWKKEPELNLMQFIVKLAEETKYEGKLEDLTDDVLIYHLKMRNSEKTEMIPGLAKDQEDDFKTAI 80  Aliivibrio ...
Q6LLI5             5 MKTHRVNELIELIHPEWKKNSDLNLVQFLLKLAEEAKYEGRLEDLTDDILIYHLKMRNSDENAMIPGIAKDCENDFKTAI 84  Photobacter...
2KO6_A            81 LRARGV 86 
WP_015699259      81 LRARGV 86  Rahnella aquatilis
P44900            81 LRARGI 86  Haemophilus influenzae Rd KW20
WP_005713307      81 LKARGI 86  Pasteurellaceae
tigr:AHA_4219     81 LKARGI 86  Aeromonas hydrophila subsp. hydrophila ATCC 7966
jgi:Tola_2973     81 LRARGI 86  Tolumonas auensis DSM 9187
UNSW:PCNPT3_12870 81 LKARGV 86  Psychromonas sp. CNPT3
Q87KC6            81 LRARGI 86  Vibrio parahaemolyticus
Q5E1Q1            81 LKARGI 86  Aliivibrio fischeri ES114
Q6LLI5            85 LRARGI 90  Photobacterium profundum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap