Conserved Protein Domain Family
EutQ

?
pfam06249: EutQ 
Ethanolamine utilisation protein EutQ
The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine. The role of EutQ in this process is unclear.
Statistics
?
PSSM-Id: 114941
View PSSM: pfam06249
Aligned: 4 rows
Threshold Bit Score: 247.486
Threshold Setting Gi: 81509350
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8XLY0   4 ISKELLEKLVRQIIEEKLAgaGNNDSVDFIRNKDKSGIMSIKLptVKVDESNRLDTGNPRDVVYTKDLFTLEESPRLGAG 83  Clostridium perfringens
Q8RH25   1 MDKELLEELIRKVIKEELG--KAEQSESEYKQMDKSGIGVVKL--NQMKKRVKMDTGNPKDQVTTTDLFTLQESPRLGAG 76  Fusobacterium nucleat...
P76555  85 FTESLVAQLMEKVMKEKQSleQGAMQPSFKSVT---GKGGIKVidGSSVKFGRFDGAEPHCVGLT-DLVTGDDGSSMAAG 160 Escherichia coli K-12
Q8Y7T4   4 ISKELIEQLVKQVVLEKMGqsS--------KHVDPSGILSVKLpvVKVSEEDRLDTGNPSDVVYTKDLVTLEESKRLGFG 75  Listeria monocytogenes
Q8XLY0  84 IMEMKETTFDWTLNYDEIDYVIEGHLDIIIDGRKISADAGEIILIPKGSKIQFSVPDYARFIYVTYPADWAS 155 Clostridium perfringens
Q8RH25  77 LMEMKETTFPWTLTYDELDYIIEGRLEILIDGRKVVGEAGDVILIPKNSKIEFSVPNYAKFLYFVYPANWSE 148 Fusobacterium nucleatum subsp...
P76555 161 FMQWENAFFPWTLNYDEIDMVLEGELHVRHEGQTMIAKAGDVMFIPKGSSIEFGTTSSVKFLYVAWPANWQS 232 Escherichia coli K-12
Q8Y7T4  76 LMEMKDTTFDWFLDYDEVDYVIEGRLDVVIDGRTVSAGPGEIIFIPKGSQIKFSVTGEARFIYVTYPADWQS 147 Listeria monocytogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap