3EGR


Conserved Protein Domain Family
PaaB

?
pfam06243: PaaB 
Phenylacetic acid degradation B
Phenylacetic acid degradation protein B (PaaB) is thought to be part of a multicomponent oxygenase involved in phenylacetyl-CoA hydroxylation.
Statistics
?
PSSM-Id: 399329
Aligned: 43 rows
Threshold Bit Score: 85.7731
Threshold Setting Gi: 81364228
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3EGR_A                  6 EWPLWEVFVRSKQGLEHKHCGSLHATDAQQALHXARDVYTRRQEGVSIWVVPSTAITASAPEEK---------------- 69 
PRJNA194094:J421_3717  17 QWPLWEVFTQEGQGAPHEHAGSVHAVDAEQALQNARDVYARRGKIVSVWVVPTASITASTPDDM---------------- 80  Gemmat...
Q5SJN7                  5 EWPRFEVIKQDTERSLPQMVGSVHATDPEHALLVARHVFVRRPSAYALFVAPAEAFFHVTQEALkdpkalegplgeeeay 84  Thermu...
jgi:Cpin_0788          28 NWNVFEVFHQEKRGAHHEHVGCVHAPDANLALIFAKEQFGRRKKCVNLWVVRSADILAFDLED----------------- 90  Chitin...
WP_013075250            9 dYEVYEVFVQYDPLEHHVHVGSVVSSSGEMALQVARENFLRRDDAVNLWVVPRGQVFATSYED----------------- 71  Kyrpid...
BAH45964                5 nFFIYEVFSQKSVNAPFVQQFSLLAPNKEVALSMARENFLRREPCFNLWVVKRDDIFGLPPEER---------------- 68  Brevib...
Q5KYA8                  8 fYQVFEVFSRKAPDAPMQHQFSLLAPNEEIALVMAQENFMRREPVADLWVVKRDYIRRMSEEEK---------------- 71  Geobac...
Q9KGB2                  9 fYQEYEVFSRKSSSAPFQLQFSLLAPNEEMALMMAQENFMRREPVDDIWVVKRSHIRSMTSSER---------------- 72  Bacill...
WP_009790823            6 FFSEYEVFSKKTDTSPMQHQFSLMAPNEELALVFAQENFMRREPVADIWVVKRSQIRKMDPEER---------------- 69  Bacill...
WP_020936539            5 TWPLFEVFVRTGRGLSHVHAGSLHAADATMALRNARDLYTRRNEGSSVWVVPAAAVSASDPDSK---------------- 68  Coryne...
3EGR_A                 70 ------------------------------------------------------------PELFDPXADKIYRHPTFYQL 89 
PRJNA194094:J421_3717  81 ------------------------------------------------------------GPFFDPGNDKPYRHPQFYKV 100 Gemmat...
Q5SJN7                 85 wvfakkshrrsmvygdlvgrflaespgeavkqalleaqgvafwavperlvvgteptpevvESWFAPAREKTYRLQSYYGL 164 Thermu...
jgi:Cpin_0788          91 ------------------------------------------------------------EDMFANNPDKTYRDASGFKV 110 Chitin...
WP_013075250           72 ------------------------------------------------------------ADFFAKEMDHSYREASGYPE 91  Kyrpid...
BAH45964               69 ------------------------------------------------------------PF-LERLDNKSYRETKGYGD 87  Brevib...
Q5KYA8                 72 ------------------------------------------------------------AA-LKRLDNKDYRLTRGYGD 90  Geobac...
Q9KGB2                 73 ------------------------------------------------------------EQWTKRLDNKHYRTTKGYGY 92  Bacill...
WP_009790823           70 ------------------------------------------------------------LT-LQRLDNKDYRTAKGYGY 88  Bacill...
WP_020936539           69 ------------------------------------------------------------GGFFESSSGKSYRHATYYTK 88  Coryne...
3EGR_A                 90 PDEV 93 
PRJNA194094:J421_3717 101 PRGv 104 Gemmatirosa kalamazoonesis
Q5SJN7                165 VTAK 168 Thermus thermophilus HB8
jgi:Cpin_0788         111 MEki 114 Chitinophaga pinensis DSM 2588
WP_013075250           92 NAKL 95  Kyrpidia tusciae
BAH45964               88 LQSR 91  Brevibacillus brevis NBRC 100599
Q5KYA8                 91 LKKR 94  Geobacillus kaustophilus
Q9KGB2                 93 LRRK 96  Bacillus halodurans
WP_009790823           89 LKKK 92  Bacillus sp. NRRL B-14911
WP_020936539           89 Aegv 92  Corynebacterium maris
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap