Conserved Protein Domain Family
DUF1013

?
pfam06242: DUF1013 
Protein of unknown function (DUF1013)
Family of uncharacterized proteins found in Proteobacteria.
Statistics
?
PSSM-Id: 399328
Aligned: 42 rows
Threshold Bit Score: 224.396
Threshold Setting Gi: 500486586
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011944300         38 LEIKNIANGEVAQGIKPINPILTNQLTQEEIDRCSNNSRAILQL-HKDDTDCLLgnKKVKKVtRYTPIARRHDKPDAIYW 116 Orientia...
jgi:HIMB59_00000530  36 LEVQSIADGEDAYKMQGLNPIASGQLTMDEIKRCEQDPSASLQL-QNKKSESIQ--TNIKAK-KYLPLSVRQERPKAIAW 111 alpha pr...
dbMIDI:303           34 LEIKGIADGDVAKGIIGLDPIVQGQLTREEIKRCEANPAANLSL-SESALRLIHeqKQKRIS-KYTPVARRQDKPEAIAW 111 Candidat...
Q2GCB1               38 LEVQAMADDLAGQKYTGRDPIHSGELNQAEIDKGQANPDYKLKM-QRAPISV----SRTKGP-RYTPVSKRQDKPDGIAW 111 Novosphi...
WP_011240724         34 LEVQAIADDTAATKLAGRDPVRAGELTLEEIEKGQKDPNYRLVI-QLPPEQN----RRPKGP-RYTPISRRQNKPDGIAW 107 Zymomona...
ELS:G432_12625       29 LEVQAIADDMAATKLTGRDPVRAGELTLAEIEKGQADPNYRLVM-LKGPEQV----RRTKGP-RYTPVSKRQDKPDGIAW 102 Sphingom...
Q1GW82               38 LEVQAIADETAATKYTGRDPVRAHELSMEEIEKGQKDPNYKLKM-TVQAQDVI---RRTRGP-RYTPVSKRQDKPDGIAW 112 Sphingop...
BAK67972             34 LEVQAIADDTAGTKYTGRDPVRAHELSMDEIHKGEANADYRLQM-LKGPDPV----RRTKGP-RYTPVSKRQDKPDGIAW 107 Sphingob...
Q2GHR0               54 LEVKGIADGEVAKGVVGCNPITMGQVTKEEIEYCQNDPTRVPRLiSYRNFKK----SKKRTV-RYTPVARRRDKPDAVAW 128 Ehrlichi...
Q2GDQ7               29 LEVEGIADGTVAHGLIGCDPRITGEVEQADIEACENDPTRKLCI------KSIVdrRKRKGR-AYTPVVKRRVKSDAALW 101 Neoricke...
WP_011944300        117 LLRTYPD-IQDYQIIKLVGTTKTTIKAIREKTHwNMKDIHARDPVLLGLCNQMELDSVVKDLS 178 Orientia tsutsugamushi
jgi:HIMB59_00000530 112 LIREYGKvLTDTQIAKLTSSTKPTVANIRAGNQ-SQPITEFRNPMDLGLCSYEDLEALVEKGQ 173 alpha proteobacterium HIMB59
dbMIDI:303          112 LLKNCPE-LSDAQIAKLVGSTKTTVLSIRDKTHwNIANIRPKDPVLLGICSQTELNLVYSHAK 173 Candidatus Midichloria mi...
Q2GCB1              112 ILRNHPE-VSDAQIGKLIGTTRTTIAAIRDRSHwNIGNINPKDPVTLGLCSQRELDAMVAKAA 173 Novosphingobium aromatici...
WP_011240724        108 IIANHPK-VTDGQISKLIGTTRETIAKIRNRTHyNMINIVPKDPVTLGLTTQRELNAIIAKVE 169 Zymomonas mobilis
ELS:G432_12625      103 IIRNHPE-VSDGQISKLIGTTRTTIAAIRDRTHwNIANIVPKDPVTLGLCSQRELDAIVAKAA 164 Sphingomonas sp. MM-1
Q1GW82              113 ILKNHPE-VSDGAISKLIGTTRNTIGAIRDRSHwNSANIVPKDPVTLGLCSQRELDALVAKAA 174 Sphingopyxis alaskensis
BAK67972            108 ILRHHPE-ISDGAIGKLIGTTRTTIQAIRERTHwNISNIQPKDPVTLGLCSQRELDLLVTKAA 169 Sphingobium sp. SYK-6
Q2GHR0              129 ILKYCPE-MQDVCIAKLIGTTKSTIAAIRNKEHwNSSNIKPRDPVLLGLCTQVDLDEAIMKAQ 190 Ehrlichia chaffeensis str...
Q2GDQ7              102 LIDKYPE-LSDAQIVSLIGTTAKIVKSIRDRTYwNYENLKPRDPILFNLYSQEDLDEALLKVK 163 Neorickettsia sennetsu st...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap