4J6E


Conserved Protein Domain Family
DUF1009

?
pfam06230: DUF1009 
Protein of unknown function (DUF1009)
Family of uncharacterized bacterial proteins.
Statistics
?
PSSM-Id: 399319
Aligned: 153 rows
Threshold Bit Score: 84.7768
Threshold Setting Gi: 308754757
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4J6E_A               138 PRGRLGKVSPAPEHMADIDKALDVAREIGRLDIGQGAVVCEGLVLAVEAQEGTDAMLRRVADLpeairgraeRRLGVLAK 217
QianUST:TMO_1769     139 PPGVWGRHAPDDQARLDIRRGLEVVQALGRLDIGQAVVVQQGIVLGVEAIEGTEALIARCGALar------pgSRPVLVK 212 Tistrel...
ACI98609             137 PEGPVGGLDAPAECRDDIGRGVAVARALGRLDVGQAVVVQQGIVLGVEAIEGTDALIDRCGDLkr------egRGPVLVK 210 Rhodosp...
IGS:MICA_1326        142 KAGRIGSREPTPEDMNAIRHGIKVAHTLGRLDIGQSVVMQQDLVLGVEGIEGTDELIRRCGLLkr------egRGPILVK 215 Micavib...
Q9ZCK1               137 NSNIITNTTITNSDKNDIELGIKVLNHLSLFDIAQSVIVKNGYILGIEAAEGTDNLIVRCADLrk------kSHGGILVK 210 Rickett...
Q4FM58               132 KRGNYTKLKANRKDINSIKMGITYFNKLKSLDHVQAIIVKDNTILAIEDQQGTKKMLSKLKKK----------SEGILIK 201 Candida...
dbMIDI:973            84 QSGLLTKTKPDPAAFADIKKGTEILKAVANFDVGQALVIQNGLVLGVEAAEGTDELIKRCGLIqq-----kdEEMCILIK 158 Candida...
goetting:PGA1_c14320 128 AEGIPTEVKPGELDKPDAERGAEVVEAMSRADVGQSCAVRRGQAIAVENLFGTDWMLNALQSRp-------dGTGGLLFK 200 Phaeoba...
Q1GGT0               128 PEGVPTKVKPGEIDKADAERAAVIAFGLSAADIGQACAVRSGQAIAIETLFGTDWMLESLAQRp-------dGQGGLFYK 200 Ruegeri...
WP_014130518         131 PQGQIGAIPAEDELLRTAEFAFSAARRAGALDLGQALVAAGARIIATEDIGGTDELLARCRAFrergligdgRGHLVLAK 210 Pelagib...
4J6E_A               218 APKPIQETRVALPTIGVATIHRAARAGLAGIVGEAGRLLVVDREAVIAAADDLGLFVL 275
QianUST:TMO_1769     213 TAKPGQERRVDWPTIGTDTIDQLRTAGFAGLALGAGRVLVLDRPAIIAAADGAGLFVT 270 Tistrella mobilis KA081020-065
ACI98609             211 VRKPQQDRRLDLPTIGTETVARAARAGFAGIAAEAGSAILLGRDQVARAADAAGLFVV 268 Rhodospirillum centenum SW
IGS:MICA_1326        216 MSKPQQDESLDLPTIGPDTIHHAALAGYAGIAVEANRSLLLDPQKVADLADQYKMFVI 273 Micavibrio aeruginosavorus AR...
Q9ZCK1               211 IPKLGQDNRLDMPTIGPNTIKNLAKYNYQGLAIQKNNVIIVEEELTIKLANKHKIFIT 268 Rickettsia prowazekii
Q4FM58               202 LPKKKQDLRMDLPTIGLQTLKDCKKYGLKGIVLRSKKNIFLDKAKCIAFANKNKIFVk 259 Candidatus Pelagibacter ubiqu...
dbMIDI:973           159 ICKPNQDKRIDLPCVGPETIKNLYRYNFKGVALEASSALILNKEETLAEADRLGIFIY 216 Candidatus Midichloria mitoch...
goetting:PGA1_c14320 201 APKPGQDRRADLPTIGVQTVELAAKAGLAGIVLEAGGVIVLNQEDVVATCNRLGLFLW 258 Phaeobacter inhibens DSM 17395
Q1GGT0               201 APKAGQDRRADLPTIGPATVAGAARAGLNGIVLEAEGVIVLDREEVVAACDRHGLFLW 258 Ruegeria sp. TM1040
WP_014130518         211 TSKPGQPLHVDLPAIGKNTVALAQMVGIEAIVVETGRTLLIGREELIAAADAAGIALI 268 Pelagibacterium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap