Conserved Protein Domain Family
GRIM-19

?
pfam06212: GRIM-19 
GRIM-19 protein
This family consists of several eukaryotic gene associated with retinoic-interferon-induced mortality 19 (GRIM-19) proteins. GRIM-19, was reported to encode a small protein primarily distributed in the nucleus and was able to promote cell death induced by IFN-beta and RA. A bovine homolog of GRIM-19 was co-purified with mitochondrial NADH:ubiquinone oxidoreductase (complex I) in bovine heart. Therefore, its exact cellular localization and function are unclear. It has now been discovered that GRIM-19 is a specific interacting protein which negatively regulates Stat3 activity.
Statistics
?
PSSM-Id: 399311
Aligned: 33 rows
Threshold Bit Score: 141.605
Threshold Setting Gi: 284088591
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EFX90408       4 TIKQDLPPPGGYEKIQYARNPAKTFFRGGRLLAGFIILNGCTTYYYFNHiYPGILHRRVEKKGSHLATLPLLLAEQDRAF 83  common water flea
Q95KV7         5 KVKQDMPPVGGYGPIDYKRNLPRRGLSGYSMFAVGIGALLFGYWSMMKW-NRERRRLQIEDFEARIALMPLLQAEKDRRV 83  cattle
XP_005999477   5 KVKQDMPPLGGYGAIDYKRNLPKRGLSGYSMFGLGIGVLLFGYWKLFKW-NRERRRLLIEELEARIALFPLLQAEIDRRA 83  coelacanth
XP_007238486   5 KVKQDMPPPGGYGPIDYKRNLPRRGLSGYAMFGIGIGVMLFGYWRMFKW-NRERRRLLIEELESRIAILPLLQAERDRQM 83  Mexican tetra
EDO40111       3 TIKQELPPKGGYAPLGFTKNLPKRGVSGWLTILGGAAVMTGGFAMVIRG-NRQRCELRKEQLQARIALLPLLQAESDRRV 81  starlet sea ane...
XP_002110536   7 KMRQEMPPKGGYPMVEYQRNLPRRGVSGAAMIIGSAAIMSFGFYLVIKG-NRHRRVLKQERLEARHFVRPLIQAEEDRRI 85  Trichoplax adha...
EFC42254      39 ELNQDVAPQGGFPAVRVRRNSPNKFWSIGTFLFISTAVMAYGWYRYYKW-IKKRDELKKEREVLELAMTPFLQAEHDIAF 117 Naegleria gruberi
XP_002892230  19 PLLQDGPPPGGFAPVRYARRISNTGPSAMAIFLTVSGAFAWGMYQVGQG-NKIRRALKEEKYAARRAILPILQAEEDERF 97  Arabidopsis lyr...
XP_015633097  19 PVLQDGPPPGGFAPVRYARRIPTKGPSAIAIFLTTFGAFAWGMYQVGQG-NKVRRALKEEKIAARTALVPVLQAEEDERF 97  Japanese rice
XP_001760295  19 PVLQDGPPPGGFPAVRYARRIANTGPSGVTVLLVSSAIIGWGMYQVGQG-NIYRRGLKAEKIAARQAILPLIQAEEDARF 97  Physcomitrella ...
EFX90408      84 LKHCRALRDEEEKLMANVPGWEVGkwngQPIYKTldKDVFSNPILSEYYCHAP 136 common water flea
Q95KV7        84 LQMLRENLEEEATVMKDVPGWKVG----ESVFHT---TRWVTPMMGELYGLRA 129 cattle
XP_005999477  84 LRLLRENLEEEAKIMKDVPGWKVG----ENLYHT---DRWVPPMTDELFNLRP 129 coelacanth
XP_007238486  84 LKMLRENLEEEAVIMKDVPGWKVG----ESVFHT---DRWVAPLSEELYNLRP 129 Mexican tetra
EDO40111      82 LRGLKENEELEALIMKDVKGWNVG----ESVYHT---NKWVTPMPEQvl---- 123 starlet sea anemone
XP_002110536  86 LRRLKCLEYEEAKIMQNVPGWVIG----ESVYHT---DRWVQPPAEqlsrf-- 129 Trichoplax adhaerens
EFC42254     118 TLQRRAFLKKVEELMKGEPEFNAY----EKFYNS--TTRFQYPVYNaqlrhfk 164 Naegleria gruberi
XP_002892230  98 VSEWKKYLEYEADVMKDVPGWKVG----ENVYNS---GRWMPPATGELrpdvw 143 Arabidopsis lyrata subsp. lyrata
XP_015633097  98 VKEWTKSLMWEEIIMKDVPGWKVG----QSVYNS---GKWMPPATGELrred- 142 Japanese rice
XP_001760295  98 VREKNKLLEEEAKVMANVPGWKVG----ENVYNS---GRWMPPSSGklgmds- 142 Physcomitrella patens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap