4O4S


Conserved Protein Domain Family
CpeT

?
pfam06206: CpeT 
Click on image for an interactive view with Cn3D
CpeT/CpcT family (DUF1001)
This family consists of proteins of proteins belonging to the CpeT/CpcT family. These proteins are around 200 amino acids in length. The proteins contain a conserved motif PYR in the amino terminal half of the protein that may be functionally important. The species distribution of the family is interesting. So far it is restricted to cyanobacteria, cryptomonads and plants. It has been shown that CpcT encodes a bilin lyase responsible for attachment of phycocyanobilin to the beta subunit of phycocyanin.
Statistics
?
PSSM-Id: 399307
Aligned: 69 rows
Threshold Bit Score: 124.221
Threshold Setting Gi: 217405460
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4O4S_J              9 TLARWXAADFSNQAQAFENPpFYAHIRVCXRPLPWEVl--------sGV-GFFVEQAydyxLNDPYRLRVLKLXI--VGD 77  Nostoc sp....
Q7NNH3             49 EVVTRLTGIMTTTQQAQSDA-ARPDVRMTTCSVQLEGdk-------skAiYLYQEQTmsnnLGAPYRQRLLRIAA--SAD 118 Gloeobacte...
jgi:Glo7428_1725   39 EVVSHLDGAMDTSAQARANP-NAPDVRITTCKVTVKNagai---arpHAvFMYQEQAlsqrLSQPYRQRFLRIAP--SVD 112 Gloeocapsa...
WP_009557191       38 KVATLLEGVMDTTAQARVNP-KAPSVQMTTCRVQVIDtnn-----htSAiFLYQEQAltskLSQPYRQRFLEISP--HPE 109 Oscillator...
B0JGA0             24 gVANHLIGVMDTREQAQTNP-RIAKVQMTTCAVDFSPkqd--------siYLYQEQAiidrLNQPYRQRILVIQP--SAD 92  Microcysti...
jgi:PCC7424_4155   32 SVVSHLVGVMDTSAQVAKNP-NKANVRMTTCQVTLTGgnd--------siYLYQEQAltktLDKPYRQRFLEIKP--TLE 100 Gloeothece...
jgi:Cyan7822_1593  32 SVVTHLVGIMDTSAQAAENP-KKSSVRMTTCQVTFRGandsvqnsfgSPvYLYQEQAltqeLNKPYRQRFLEIQP--SVG 108 Gloeothece...
jgi:GEI7407_2966   37 EVADRLVGTLSTVHQALTSR-RVADVRMVTCPVTVTDaap-----apGVsFLYQEQAialnPEQPYRQRFLRIAP--YPA 108 Geitlerine...
ACI98479           40 TLAALLTGSFSTAQQAAADP-RVPPLRRQVTPIWPRRh--------dGP-WLYVEEApeddRDRPIRQAIMQIRF--APE 107 Rhodospiri...
WP_015361127       31 KVYKMMQGSYDSSLQSKVDS-SYYDISLEMHPVWKNS----------GErWLYVEQAltsqKDQPYRVRMYRLLRndNNE 99  Nonlabens ...
4O4S_J             78 r--IHIENYTVKQEEnfygasrdlNRLQTLTSESLEKLPGCNXIVEWT-GNSFKGTVePGKGCIVVRKGQKTYLDSEFEI 154 Nostoc sp....
Q7NNH3            119 graVESAGFKFVEAKplaglcakpAAERLIAPMALDGDPTCTVRLVQa-GDKYMGTT-PEGGCQSNVRG-AARITNEITL 195 Gloeobacte...
jgi:Glo7428_1725  113 hnsIESAVFRPPTPQawiglcnkpEAQRIINVKDIGT-SNCSVFLGRq-QQNYIGET-SASGCPSNYKG-AVRITNRITL 188 Gloeocapsa...
WP_009557191      110 tqtVRSRSFRLTQPErwagfcnqpDAQRTLQSRDLGN-PVCSVFLKQt-PTGFLGET-PPEGCPTNARG-AVRITNTIEL 185 Oscillator...
B0JGA0             93 nstVESKAYKLNNAPnfinfcnkdLTERELNVSDLAE-SVCTVFLQPi-AGGYRGET-PPQGCPTNARG-AVKITNTIIL 168 Microcysti...
jgi:PCC7424_4155  101 petVESKSYKPLQAErligfcnkpLSERVLNVSELGE-PVCSVFLKPs-NNGYLGET-QPEGCPANVRG-AVTITNTILL 176 Gloeothece...
jgi:Cyan7822_1593 109 qetVESKSYKPAQPEtliglcnkpESERVLQQSDLGE-FVCRVFLKPs-PDGFIGET-PPEGCPANVRG-AVKITNTIIL 184 Gloeothece...
jgi:GEI7407_2966  109 sqsVESTAWKPPELApwvglcqkpLAQRQVRLADLGS-PLCQVYLKPa-GDRFVGAT-PPEGCPSNFRG-ATRVTNQIVL 184 Geitlerine...
ACI98479          108 rggVELRSYRLPDPAaavgawrdpARLKALMPEQLDRIAGCEVVLYRRgEWTFSGNT-VGTDCADP-DGRAAYRLIQMSV 185 Rhodospiri...
WP_015361127      100 ---IISEVYTIPNEKqyygkfkkpKAFKYLTPDYLEKREGCEVIIQKEeNGSYTGKT-GKSTCLSTMRG-ASYATSIVVI 174 Nonlabens ...
4O4S_J            155 NEEKFISLDRGRDLEtDAHIWGSVAGPFYFVR 186 Nostoc sp. PCC 7120 = FACHB-418
Q7NNH3            196 YKEGMDTRDRGFDAQ-GNQVWGAKEEPYRFRR 226 Gloeobacter violaceus PCC 7421
jgi:Glo7428_1725  189 HQAGMDTWDRGFDAT-GNQVWGAEGEAYQFRw 219 Gloeocapsa sp. PCC 7428
WP_009557191      186 NTAGMNTWDRGFDAD-GNQVWGAQSESYQFRR 216 Oscillatoriales cyanobacterium JSC-12
B0JGA0            169 HSQGMDTSDRGYDSL-GQQVWGAQDNVYQFRw 199 Microcystis aeruginosa NIES-843
jgi:PCC7424_4155  177 HSEGMDTWDKGYDAQ-GNQVWGANDDPFEFRw 207 Gloeothece citriformis PCC 7424
jgi:Cyan7822_1593 185 HSRGMDTWDKGYDAQ-GHQVWGAREDAYQYRw 215 Gloeothece verrucosa PCC 7822
jgi:GEI7407_2966  185 EADRMETWDRGFDAA-GQQVWGAQDESYQFRR 215 Geitlerinema sp. PCC 7407
ACI98479          186 QSAFTRIWERGFTGA-GEAVQETAAGGLRFDK 216 Rhodospirillum centenum SW
WP_015361127      175 NDNQIISWDRGFDKD-GNQVWGAEKGGYIFMK 205 Nonlabens dokdonensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap