Conserved Protein Domain Family
5-nucleotidase

?
pfam06189: 5-nucleotidase 
5'-nucleotidase
This family consists of both eukaryotic and prokaryotic 5'-nucleotidase sequences (EC:3.1.3.5).
Statistics
?
PSSM-Id: 399298
Aligned: 83 rows
Threshold Bit Score: 377.59
Threshold Setting Gi: 971397602
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011738037  43 KHQEKNEKVVLQPGVGFSLVKKLLALNT--------TKNPIDVILLSRNSADTGLRIFNSIEHFGLNISKAAFTCGESTH 114 Candidatus Ruth...
XP_002586936  48 QYMVEREDVILPKGPAFEFVRSALAVNDhireldpkDIELFDIVIVSRNHTQAAVRLINSINHY----------EGTDPT 117 Florida lancelet
XP_002593437  38 QHMVERENEVLGKGPAFEFVESALAVNDrirkldpkDNELFDIVIVSRNHAQAAVRLINSINHYGLCLERITLAGGADPT 117 Florida lancelet
XP_001636326  65 aLQVRREDNMLKPGSAFPFIKALENVNRklrekdpkEQEIFSIVLMSHNNAQVGIRLQKSIDHNGLMIPRMALTGGTSPV 144 starlet sea ane...
XP_002127185  84 KHMISRENEPLKPGSAFPFVQALTCINLrlleldpnEKHLFDVVLMSNNSAQIGVALINSINYHALTIERICLTAGKSVT 163 vase tunicate
Q91YE9       298 EYQLTNENVILTPGPAFRFVKALQHVNSrlrdlypdEQDLFDIVLMTNNHAQVGVRLINSVNHYGLLIDRFCLTGGKSPI 377 house mouse
XP_007506158 268 EYQVLNENVILSPGPAFGFIKALQSVNArlrslypkEQDLFDIVLMTNNHAQVGVRLINSINHHGLLIDRFCMTGGESPI 347 gray short-tail...
XP_690184     77 QHQQDNENQPLNPGPAFPFVKALMTVNErlrelypeSEELFDIVLMTNNHAQVGVRLMNSINHYDLTIERFCMTGGQSPI 156 zebrafish
XP_003227434  87 KYQLDHENEAFLPGAAFPFVKALEAVNKqlrelypdSEELFDIVLMTNHHAQVGVRLINSINHYNLFIERFCMTGGNSPI 166 green anole
XP_003962623  80 KHQVEHESQPFCPGPAFSFVKALEAVNTrlreinpdSEELFDVVLMTNNHANVGLRLINTINHYKLFIERFCMTGGNSPV 159 torafugu
WP_011738037 115 NLVSAFKADLFLSSNYQDVQKALESGFAAASIV-GSS-SQKPHETQLRIAFDGDAVIFSNESERIFQEKGLRAFVENEKN 192 Candidatus Ruth...
XP_002586936 118 TYLEAWKVDLFLSPEEGDVRRAIQAGYPAALVY--QSeTADLPHDQLRIVFDGDAVLFSDEAERVYQEGGFPLFFQNETV 195 Florida lancelet
XP_002593437 118 TYLGAWKADLFLSPDEDDVRSAIKAGFPAAVVYkYNGe--DLPNDQLRIVFDGDAVLFSDEAERVYQQRGFPAFVENERQ 195 Florida lancelet
XP_001636326 145 KYLEAFNITLFLTSYEEEVADAIQQGFPAAHM--STQtIRSPSETQLRVAFDLDAVLFSDESEKIYKEKGLQGFLENEIE 222 starlet sea ane...
XP_002127185 164 GYLAAYGTDLYLSADSDNVVEALNEGIAAATVF-SGDgAVQSSCEQLRIAFDGDAVLFSDESEIIAKEHGLTKFFENEAE 242 vase tunicate
Q91YE9       378 GYLKAYLTNLYLSADSEKVQEAIKEGIASATMY-AGAkDMAYCDTQLRVAFDGDAVLFSDESEHIAKDHGLDKFFQHETL 456 house mouse
XP_007506158 348 GYLKTYLTNLYLSADSDKVQEAIEEGIAAATMY-LGNkDLPFSDTQLRVAFDGDALLFSDEEEQSVEK-GSDKNSQNP-F 424 gray short-tail...
XP_690184    157 GYLKAYMTNLYLSRDSKKVGEAIEEGIAAATMF-KSDvETQLSETQLRVAFDGDAVLFSDESEIIVKQHGLDTFFEHEKQ 235 zebrafish
XP_003227434 167 DYLKAYHTNLYLSSDCEKVTDAIEEGIAAATIF-SPNrDVQVSDDQLRVAFDGDAVLFSDESEQIVKAHGLDKFFEHEQT 245 green anole
XP_003962623 160 GYLKAYHTNLYLSADPVKVREALEEGIAAATMF-TPEkMTEVSETQLRVAFDGDAVLFSDESERIFKAHGLDKFFEHEKA 238 torafugu
WP_011738037 193 SANIVLKAGPFKCFL---MSLQKIQSAFPvTNN-----PIRTALVTARSAP-SHKRVIHTMRKWGIRIDESFFLGGLDKG 263 Candidatus Ruth...
XP_002586936 196 KVSTPLDEGPMTKFA---LRISAMQQKFH-KKRvp--cPIRTYLLTARSGAsTGKRAILTLRHWCLQIDECNFNAGAGKG 269 Florida lancelet
XP_002593437 196 KAGMPLDEGPLRKFA---SRIAAIQEKFH-TKEvp--cPIRTYILTARSGAsAGKRAILTLREWGLKIDECTFNAGASKA 269 Florida lancelet
XP_001636326 223 HRDIPLSEGPLKRFA---EALGRMQKKFE-RQDin-ncPIRTYIVTSRDAI-VGQRALKTLRHWGLEIDECFFMAGAPKD 296 starlet sea ane...
XP_002127185 243 KADQPLEIGPLQKFA---MVLGDVKKKFT-DRGiiencPIRTYLVTARSAAsSGLRALRTLRLWGLDIDEALFLAGAPKG 318 vase tunicate
Q91YE9       457 FENKPLAQGPLKSFL---EDLGKLQKKFY-AKDerllcPIRTYLVTARSAAsSGARVLKTLRRWGLEIDEALFLAGAPKG 532 house mouse
XP_007506158 425 NENKPLAQGPLKEFL---QDLGRLQKKFY-AKDermlcPIRTYLITARSAAsSGARVLKTLRAWGLEIDEALFLAGAPKG 500 gray short-tail...
XP_690184    236 HENKPLAQGPLKCFL---EALGKLQKKFY-AKNerlncPIRTFLVTARSAAsSGARVLKTLRSWGLEIDEALFLAGAPKG 311 zebrafish
XP_003227434 246 YENKPLAQGPLKGFLipgESLGKLQKKFY-SKGlrlecPIRTYLVTARSAAsSGARALKTLRSWGLETDEALFLAGAPKG 324 green anole
XP_003962623 239 HENKPLDHGPLKGFL---EALGKLQKRFY-DKGqrldcPIRTYLVTARSAAsSGTRALKTLRSWGLEIDEALFLAGAPKG 314 torafugu
WP_011738037 264 IFLKEFGADIFFDDQHQHCQSASKY-VPTGHVPNG 297 Candidatus Ruthia magnifica
XP_002586936 270 AMLRAIRPHLYLDDSQRNIDAALQEnICAARVLYG 304 Florida lancelet
XP_002593437 270 AMLKAIKPHLFFDDSPSHIDAALEEnIPAARVLYG 304 Florida lancelet
XP_001636326 297 GVLAAIIPHIFFDDQISHISQAREKgTPSAHVSYG 331 starlet sea anemone
XP_002127185 319 PILEKIKPHLFFDDQKRNVDSGLEYgVKAAHVPYG 353 vase tunicate
Q91YE9       533 PILVKIRPHIFFDDQMFHIESAQKFgTITAHVPYG 567 house mouse
XP_007506158 501 PILVKIRPHIFFDDNMFHIKGVEKFgTIVASVPFP 535 gray short-tailed opossum
XP_690184    312 PLLQKIRPHIFFDDQMFHIEGAKEMgTIAAHVPYG 346 zebrafish
XP_003227434 325 PLLEKIRPHIFFDDQMFHVEGAKEMgTIAAHVPYG 359 green anole
XP_003962623 315 PMLEKIRPHIFFDDQMFHVERAAEMgTVACHVPYG 349 torafugu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap