1K4N


Conserved Protein Domain Family
YecM

?
pfam06185: YecM 
Click on image for an interactive view with Cn3D
YecM protein
This family consists of several bacterial YecM proteins of unknown function.
Statistics
?
PSSM-Id: 399295
Aligned: 41 rows
Threshold Bit Score: 182.378
Threshold Setting Gi: 328866514
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1K4N_A            13 ELQDIASDLPRFIHALDELSRRLGLNITPLTADHISLRCHQNATAERWRRGFEQCG-ELLSENXINGRPICLFKLHEPVQ 91  Escherichia...
EGG14898          15 EDKEIIGDYKLFLDLLFQGIKGLGINVDGLELDHLCYRVSLEEYYDVKKNEILSSGhEMLTEVNYNGRRISSFKLTQPIL 94  Cavenderia ...
EGG20883           6 TLKTLIGDYDVFLPILFKHLYKCGLPVDQLESDHICYRVSSQENYDTKKEAFLKDGhELLSEAVINGRPICTFKLQQPIV 85  Cavenderia ...
ACL32825          18 NLTACFGDLAEFERKIAQIAKIAQIDLSQYQIDHLAVRMNSDEVANQWKAMLLTGS-TLLKESEVNGRPIGLFTLNQPVH 96  Glaesserell...
USMARC:WQG_20360  11 KLTACFGNLAEFEQKIQQIAEICGIDLSQFEIDHLAVRMNQLETAKIWREMLLTDA-TILKESEVNGRLIGLFILNQPLI 89  Bibersteini...
P44262             7 NLTALSADLAIFERKIQHLAKEMTIDLSHYEIDHLALRVNSEQSAKNWLILLLKCG-RILSDNIVNGRKIYLIELEKPVK 85  Haemophilus...
Q9CN85            28 QYAEHFVQFRTFEHNIQQLAEIMHLDLSQYEIDHIALRVNTEQSAKYWLTLLLKYG-TILSDNLVNGRIIYLIKLDSPLL 106 Pasteurella...
WP_012340574      13 qsnisLDEFEQFERKIIELAHFMQLRLDRVEIDHIALRVNKRKSAEDWLTLLLKCG-TILSGNIVNGRVIYLIQLDNPIR 91  Histophilus...
Q65SX5            13 hlpanYGEFSDFEQKIATLAQEMKVDLSLYEIDHLSIRVNTEDKAKSWLTTLLNYG-KILSNNLVNGRAIYLIELEQPLL 91  [Mannheimia...
WP_012072855      15 NSTALYREYVDFERKIRALAAEMRINLADYVIDHLALRVNSLEAGKNWLERLLKCG-TILSDNLVNGRIIYLIRLEEPLP 93  Actinobacil...
1K4N_A            92 VA---------HWQFSIVELPWPGEKRYPHEGWEHIEIVLPGDPEtlnaralALLSDEGLSLP----------------- 145 Escherichia...
EGG14898          95 YEyqsnngtseTKVIPLLELPSHKPSKPQLDGLEHFYFVTSQSFQ-------DIKHQHDQAVKasngrftwveidiankf 167 Cavenderia ...
EGG20883          86 WNytnaagqqqTRQIPLVELPSPKPSKPQVDGLEHVEFVTTQEFQ-------SFIDQYDAQIKqhggakwil-aalkkei 157 Cavenderia ...
ACL32825          97 FC---------GQAVSVIELPFPKGKSYPEEGWEHIEIIIPMYENenveqwcKRIDEQFSLQAn---------------- 151 Glaesserell...
USMARC:WQG_20360  90 FC---------NQSVSIIELPFPKGKTYPQEGWEHIEIVVPMQENesveqwiERCCKRWNLQEn---------------- 144 Bibersteini...
P44262            86 FA---------NQFVDIIELPLPKNKKYPIEGWEHIEIVMPFLPKesinewiNRVNMYFLXLT----------------- 139 Haemophilus...
Q9CN85           107 FL---------GQSIDVIELPFPKNKSYPVEGWEHIEIVMPFLPHetvekwvARINHTFLWELs---------------- 161 Pasteurella...
WP_012340574      92 FS---------DQFIDIIELPFPKDKVYPVENWEHIEVVIPFEVNetvdewvTRIRQQFLWDEl---------------- 146 Histophilus...
Q65SX5            92 FM---------GQRVFIIELPFPKNKHYPVESWEHIEFVIPFLPNessiewvERVQQQFLWNQs---------------- 146 [Mannheimia...
WP_012072855      94 FL---------NQFIDVIELPFPKDKIYRYETWEHIEFVIPLLAKestnewiNRIQSVFLWNQf---------------- 148 Actinobacil...
1K4N_A           146 --GISVKTSSPKGEHERLPNPTLAVTD------GKTTIKFHPWSIEEIVAsE 189 Escherichia coli
EGG14898         168 npNIELEMELSKDEKIALNTPKEVIDNr-----RSISVKFHPKSLQDMID-E 213 Cavenderia fasciculata
EGG20883         158 naDVEVECELTKEDKLALNHPSDSIDQr-----RTFSAKFHHESLEKVIEyE 204 Cavenderia fasciculata
ACL32825         152 -pELKIKISQPQVEGERLPNPSVAISLknatyqNFCCLKLHPYDLNvsll-- 200 Glaesserella parasuis SH0165
USMARC:WQG_20360 145 -lQIHLKISQPQVAGELLPNPSIAISLnke-fyNFCALKLHPYSIQEICRqn 194 Bibersteinia trehalosi USDA-ARS-USMARC-192
P44262           140 --QLTIKVSEPKVDGERLPNPSIAVSFtdk-tvNHTCIKVHPYSIKKYLRfs 188 Haemophilus influenzae Rd KW20
Q9CN85           162 -dNLNVKLSEPRVEGEQLLNPSIAVSFvdk-qhNPTCIKVHPYHIKKIIEaE 211 Pasteurella multocida
WP_012340574     147 -aNLKVKVSEPKADGEQLPNPSIAVSFvnq-leNHTCIKVHPYHIKKIIEg- 195 Histophilus somni
Q65SX5           147 -gNLTIKVDEPKVDGEQLPNPSIAVSFadk-sqNHVCIKVHPFNIKNIIKvs 196 [Mannheimia] succiniciproducens MBEL55E
WP_012072855     149 -dRLTIKVSEPKAEGELLPNPSIAVSLkdn-srNHVSIKVHPYSIKKIVEvf 198 Actinobacillus succinogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap