1STM


Conserved Protein Domain Family
Potex_coat

?
pfam06184: Potex_coat 
Click on image for an interactive view with Cn3D
Potexvirus coat protein
This family consists of several Potexvirus coat proteins.
Statistics
?
PSSM-Id: 399294
Aligned: 2 rows
Threshold Bit Score: 246.907
Threshold Setting Gi: 75551050
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1STM_E   5 RSRRSNRRAGSRAAATSlvyDTCYVTLTERATTSFQRQSFPTLKGMGDRAFQVVAFTIQGVSAAPLMYNARLYNPGDTDS 84  Panicum mosaic satell...
Q6XXR6   1 MVGRRNRRQRSRVSQMT---DIMYGSLTLGSTTTWTRKNFPGLANMGDRPFQVISAKIVVSSASPMLYQARLYSPHDDDN 77  Bamboo mosaic virus s...
1STM_E  85 VHATGVQLMGTVPRTVRLTPRVGQNNWFFGNTEEAETILAIDGLVSTKGANAPSNTVIVTGCFRLAPSELQSS 157 Panicum mosaic satellite virus
Q6XXR6  78 VGSTGLQMSGTTPRTHRMRALPGQNTWFSGNTSSTQVIVAIDGLKTKTSDVTPQNAVAVQISYRVAPSELQSA 150 Bamboo mosaic virus satellit...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap