Conserved Protein Domain Family
MiaE

?
pfam06175: MiaE 
tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE)
This family consists of several bacterial tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE) proteins. The modified nucleoside 2-methylthio-N-6-isopentenyl adenosine (ms2i6A) is present at position 37 (3' of the anticodon) of tRNAs that read codons beginning with U except tRNA(I,V Ser) in Escherichia coli. Salmonella typhimurium 2-methylthio-cis-ribozeatin (ms2io6A) is found in tRNA, probably in the corresponding species that have ms2i6A in E. coli. The miaE gene is absent in E. coli, a finding consistent with the absence of the hydroxylated derivative of ms2i6A in this species.
Statistics
?
PSSM-Id: 114868
View PSSM: pfam06175
Aligned: 6 rows
Threshold Bit Score: 296.694
Threshold Setting Gi: 81771186
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8CX43   3 QLLAPVHAFLRCETPQTWIDVARASASLDELLIDHCNCELKAAQTAMFLLRRYAlnaesgqsllawakpyeefvyhkdrd 82  Shewanella oneidensis
Q9KQT8  11 QLLEPINHFLQCPTPDEWVEEARKPENLRVLLLDHLLCELKAGQSAMFLIRKYAvdkeselslldwfkpyedfayrk--- 87  Vibrio cholerae
Q08015  21 QILSPVLNFLHCPTPQAWIVQARDPQNLPLLLTDHLICELKAAQTALLLVRKYVadksgadallswlqpyeafafrq--- 97  Salmonella enterica s...
Q9I2V2   4 TMLPEIDQFLACSTPAAWVEAALERQ--DVMLLDHKACEMKAAATAMQLIGKYS-------------------------- 55  Pseudomonas aeruginosa
Q8DGE6  14 IETPVRIKFLLQPTRREWVEQA--IAHLDTILLDHSHCERKAAGVAINLMFRY--------------------------- 64  Synechococcus elongatus
Q8YT06   3 TPVLPKINVLKQTTSEAWIEQA--IANLDIILLDHSHCERKAAGVALNFMFRY--------------------------- 53  Nostoc sp. PCC 7120
Q8CX43  83 ieqflardvkknelvavlqpnqhfSFAQDLIPPLIRLIKEEFHHFEQVLELMHARQIPYRNIRAGRYAKGMMSHVTTHEK 162 Shewanella oneidensis
Q9KQT8  88 -igdiqslkgksqiskaiiaksdsPYSQDLIDKMVLLIKEELHHFYQVLEIMQARNVEYESIPASRYAKSLLAHMKTHEP 166 Vibrio cholerae
Q08015  98 -gpepdfvalhkqisksampqtddPWGRQLIDRMVLLIKEELHHFWQVREVMQARNIPYVKITASRYAKGMLKAVRTHEP 176 Salmonella enterica s...
Q9I2V2  56 -------------------------GRLDLVNKMSRLAREELRHFEQVLAILKKRGIRVVNVSASRYASALRDLVRKQEP 110 Pseudomonas aeruginosa
Q8DGE6  65 ------------------------PSHKPLVNALTDIAQEELDHFRQVNQQLERRHIALAPLSPPPYASRLNAAVRQQEP 120 Synechococcus elongatus
Q8YT06  54 ------------------------PSNTKMVRELTAIAREELEHFELVNQWLERRNIPLAPLPPPPYGAGLKAAARTNEP 109 Nostoc sp. PCC 7120
Q8CX43 163 NILRDKLIVGAYIEARSCERFAKLAPYL-DAELSKFYVSLLRSEARHFEDYLKLAQLVSSE-DISERVAYFGEREAELIM 240 Shewanella oneidensis
Q9KQT8 167 QTLIDKLIVGAYIEARSCERFAKLAPYL-DDEIAKFYVSLLRSEARHYQDYLQLAEQIAGY-DISERVAYFGRVEAELIS 244 Vibrio cholerae
Q08015 177 LTLIDKLICGAYIEARSCERFAALAPWL-DEDLQTFYLSLLRSEARHYQDYLALAQQISAE-DISARVRYFGEVEADLIL 254 Salmonella enterica s...
Q9I2V2 111 QRLTDTLVVGAFIEARSCERFAALVPHL-DAELAKFYGGLLKSESRHFQDYLKLAYQYGDEaDVERTIEVVRAKEAELIS 189 Pseudomonas aeruginosa
Q8DGE6 121 QRLLDRLLVCALIEARSHERLQLLAQHCpEGELAAFFASLVTSEARHYGTYWSLAYGSFGQeVVAERLQQLAALESEILS 200 Synechococcus elongatus
Q8YT06 110 ERFLDSLLVTGLIEARSHERLGLLATHCpEPELAKFYKGLMASEARHFGTYWVLADTYFDReIVSQRLDELAIVESELLE 189 Nostoc sp. PCC 7120
Q8CX43 241 APDDEFHFHS 250 Shewanella oneidensis
Q9KQT8 245 TPDSDFKFHS 254 Vibrio cholerae
Q08015 255 SPDREFRFHS 264 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
Q9I2V2 190 SPDNEFRFHS 199 Pseudomonas aeruginosa
Q8DGE6 201 TPYPLPRMHS 210 Synechococcus elongatus
Q8YT06 190 NLHPEPRIHS 199 Nostoc sp. PCC 7120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap