4UXV


Conserved Protein Domain Family
EzrA

?
pfam06160: EzrA 
Click on image for an interactive view with Cn3D
Septation ring formation regulator, EzrA
During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerizes into a ring structure that establishes the location of the nascent division site. EzrA modulates the frequency and position of FtsZ ring formation.
Statistics
?
PSSM-Id: 399279
Aligned: 60 rows
Threshold Bit Score: 389.594
Threshold Setting Gi: 524723571
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4UXV_A         1 GSHMRKKIYAEIDRLESWKIEILNRSIVEEMSKIKHLKMTG-QTEEFFEKWREEWDEIVTAHMPKVEELLYDAEENADKY 79  Bacillus subtil...
BAH18095      19 LFYMRNQRRTHIESIEARKNEVKHLPFQDELVKIKSLNLKG-QAALHFEKWKKEWQTVLNEDIKACELIINDADEALDKF 97  Macrococcus cas...
Q2FXK8        20 LFYLRSNKRQIIEKAIERKNEIETLPFDQNLAQLFKLNLKG-ETKTKYDAMKKDTVESTNKYLAPVEEKIHNAEALLDKF 98  Staphylococcus ...
CCZ23176      34 rLLKLKHYRNEIVDLENKMNAIKSLPIQYRLGRVKGIAKNMpELQEKYETYDAKFAELTDLQNDEIIPLVNDIDEALYYR 113 Coprobacillus s...
WP_008817344  35 MVLRQKQARKQLDELELSYNSLKGIPLAFKLNKAVALSRVNeEMSQRVESCRTDFDNIQE-QLKECSVTLAEADDLIYVH 113 Firmicutes
EDP11281      35 MVMRKKQTIKQLEQLEQRYNTLKGIPLAFKLNKAVALSRVNeAMSTVVEECKTDFDEVQE-KLKTCSVDLAECDDLIYGH 113 Absiella dolich...
B9DRR4        23 GVIIRKRNDSMIGTLEDRKQHLFGLPVNEEIEEVKELHLIG-QSQTSFREWNQKWVDLTLNSFADIENHLFEAEKYNDTF 101 Streptococcus u...
A4VWI6        23 CLIVRKRNDNLLVALEERKEELFNLPVNEEVETVKALHLIG-QSQVSFREWNQKWVDLSLNSFADIENHIFEAEGYNNAF 101 Streptococcus s...
Q8DQE5        24 AIFLRKRNEGRLEALEERKEELYNLPVNDEVEAVKNMHLIG-QSQVAFREWNQKWVDLSLNSFADIENNLFEAEGYNHSF 102 Streptococcus p...
WP_022093723  38 NSMRRRKAASRFEELEKEVNEVRNNSLDYKFNKAKAFSKANaDIMERVNELSPKYKICIK-GMDDCDTLCERANDYLDGH 116 unclassified Fi...
4UXV_A        80 RFKKANQVLVHIDDLLTAAESSIEKILREISDLVTSEEKSREEIEQVRERYSKSRKNLLAYSHLYGELYDSLEKDLDEIW 159 Bacillus subtil...
BAH18095      98 KFKESETKVQEADRLLDHIEKKYGQSVEEIKAFMNKTDDDKRMYDACKIIYRESKRDVLANRHQYGESAEPLEAQIEKYE 177 Macrococcus cas...
Q2FXK8        99 SFNASQSEIDDANELMDSYEQSYQQQLEDVNEIIALYKDNDELYDKCKVDYREMKRDVLANRHQFGEAASLLETEIEKFE 178 Staphylococcus ...
CCZ23176     114 KLRGVQKKMNSLEEKVIHYAKESKQLLKDIEVITEIENIQRLEIIKVKEKYRATNDNYAQIRFKVEDYVPKVQDVFHDID 193 Coprobacillus s...
WP_008817344 114 KAKAAKRRMEKLREQMAELEGVAKDVNQALDSILEQENEQRVHINKLKDDFRIIKRNINENRASFSQSYEYLEMEIAAIE 193 Firmicutes
EDP11281     114 KVKAARRRLNELSDDLALCETDVNKIHTVLDDILEQENEQRVHINALKETFRKVKKTIHENRTAYSQSYEYLETEIIAIE 193 Absiella dolich...
B9DRR4       102 NFIRAKHEINNVESQLNLVEEDITSIREALSILKEQEEKNSARVTHALDLYEKLQSSVAENDSHFGTTKPEIEKQMKNIE 181 Streptococcus u...
A4VWI6       102 RFVSAKNAIDSIDSQIDLIEEDIASIRQGLMELKEQEEKNSGRVKHALNLFDSLQEAVRENPDSYGETLSELEKQLKNIE 181 Streptococcus s...
Q8DQE5       103 RFLKASHQIDQIESQITLIEEDIAAIRNALADLEKQESKNSGRVLHALDLFEELQHRVAENSEQYGQALDEIEKQLENIQ 182 Streptococcus p...
WP_022093723 117 RTKKAMRTMDELETCLDDARERIRIVTKALDNILEKETEVRDFANALKERFASVKTVYQNNRPAYFKATTYFDSRIQEIE 196 unclassified Fi...
4UXV_A       160 SGIKQFEEETEGGNYITARKVLLEQDRNLERLQSYIDDVPKLLADCKQTVPGQIAKLKDGYGEMKEKGYKLEHIQLDKEL 239 Bacillus subtil...
BAH18095     178 PQINVYQTLIDEGNYDDAHMHINRLHEEMSLLKKDMEEIPELIRDVQKELPAQFQDIKFGCRDLKIEGYNIEHVKVDSTL 257 Macrococcus cas...
Q2FXK8       179 PRLEQYEVLKADGNYVQAHNHIAALNEQMKQLRSYMEEIPELIRETQKELPGQFQDLKYGCRDLKVEGYDLDHVKVDSTL 258 Staphylococcus ...
CCZ23176     194 ERFVELENYMNNQQFEEAKTYTEDISKYIDALDQQLSDLPTYISVVRQYLPKRLNELKSIMQDMQEKDFAVERMNATIRI 273 Coprobacillus s...
WP_008817344 194 KMFSAFEEWMFASEFNKAADQQKEIRESVAHLKELVDVLPSMYERARGVLPRAIDEVGYQYAQAKNKGVYTEHLEVRKNL 273 Firmicutes
EDP11281     194 KMFSKFEEWMFASEFNKAADQQKEIKESITRLNEIVEALPSLYERAKGILPRAIDEVGYNYARAKNKGVLLEHLEVSKNL 273 Absiella dolich...
B9DRR4       182 TEFSQFVTLNSSGDPVEASEVLDRAEEHTIALGQITEQIPAIVAKLEDEFPDQLDDLESGYRRLLEDNYHFAENNIEEKF 261 Streptococcus u...
A4VWI6       182 VEFSEFVMLNSSGDPIEASEILDKTEEHMIALNQIMDRIPSLIERVTKDFPEQLEDLESGYRKLVEQNYLFTEANIESQF 261 Streptococcus s...
Q8DQE5       183 SEFSQFVTLNSSGDPVEAAVILDNTENHILALSHIVDRVPALVTTLSTELPDQLQDLEAGYRKLIDANYHFVETDIEARF 262 Streptococcus p...
WP_022093723 197 NEFTSFEEWMYASEFNKAKDEGDKIAKEIDVVSSEVASCPDLYERAMAIIPAAVNEIRENEAELTKANVDLAYLETDKKL 276 unclassified Fi...
4UXV_A       240 ENLSNQLKRAEhVLMTELDIDEASAILQLIDENIQSVYQQLEGEVEAGQSVLSKMPELIIAYDKLKEEKEHTKAETELVK 319 Bacillus subtil...
BAH18095     258 QTLKGKLNLVE-PLIARLELDKAEEIIDEINDAIDDMVELVELEVKAKNNVELTKEEITDHLFHAKDTNYMIRTEIEYVK 336 Macrococcus cas...
Q2FXK8       259 QSLKTELSFVE-PLISRLELEEANDKLANINDKLDDMYDLIEHEVKAKNDVEETKDIITDNLFKAKDMNYTLQTEIEYVR 337 Staphylococcus ...
CCZ23176     274 SKIDNDLHETE-KNIKNLKLENVGQNIEVMTDELNLLYSDFEKEKNAYALYEEKRNECYKFVNKIESGLLEAKESIHELE 352 Coprobacillus s...
WP_008817344 274 DIISDMLKNDL-NKLRNGNPKDVHEDLNDCEKRISQLAEQLSREEAAFDEVSDNVDILFDTIRSINMDVEAIEELYNRVY 352 Firmicutes
EDP11281     274 DVISDMLKNDL-NRLHSGTPENVKEDLDDLEVRIAQLAEQIRLEEEAFDEVNDGLTALFDSIREVNCEFDDIKSLYARVY 352 Absiella dolich...
B9DRR4       262 QEIREAIRSNA-SELVSLDLDRAREENSHIQERIDNMYALFEHEIKAFKVSAKHSKIIPSYLEHAKSNNDKLKEEMTRLS 340 Streptococcus u...
A4VWI6       262 QNIRVSIRENT-ALIVSFDLDAAEAENEGIQAKIDHLYKVFNREIEANKEAVKISKNLPKFLEHVVQNTQLLDEESQRLN 340 Streptococcus s...
Q8DQE5       263 HLLYEAFKKNQ-ENIRQLELDNAEYENGQAQEEINALYDIFTREIAAQKVVENLLATLPTYLQHMKENNTLLGEDIARLN 341 Streptococcus p...
WP_022093723 277 NTVSENLQASI-HLIDIGNLADAQMVLSDITDTILNLQDQMNAEKDAYNEIHDGLAQNVISVDEIDVQLNEIKTLYGNIR 355 unclassified Fi...
4UXV_A       320 ESYRLTAGELGKQQAFEKRLDEIGKLLSSVKDKLDAEHVAYSLLVEEVASIEKQIEEVKKEHAEYRENLQALRKEELQAR 399 Bacillus subtil...
BAH18095     337 DTYYIDEEAVQNVRGYDNEIQSLITVYDEILMETAKSSIRYTEVEDNLKYIESHVKVINEKQEKIQNYLMNLREDEQEAQ 416 Macrococcus cas...
Q2FXK8       338 ENYYINESDAQSVRQFENEIQSLISVYDDILKEMSKSAVRYSEVQDNLQYLEDHVTVINDKQEKLQNHLIQLREDEAEAE 417 Staphylococcus ...
CCZ23176     353 KNYILGDYTITIEDDYN-QFQSIVDDLAEITKIIETKDFSYIEMIDDFSRIVEQSKPYNDSLIKHIELAETLRIQEKRAL 431 Coprobacillus s...
WP_008817344 353 ERFGF-ENWTQRLQEVHERLSVLNDMQRKLEAVIAQNKVPYSTILIAYKELEQSAAAFTNEVGEMKQKLDNACSDEERAK 431 Firmicutes
EDP11281     353 ERFGF-ENWTQRLQDTQTRLDVLNDMQRRLDKIVLDKQVPYTTILIAYKELAQSNAGFSKEVELMKEKLNNACSDEERAK 431 Absiella dolich...
B9DRR4       341 RKYILNENQASTVQGFEKEIEDVEKNVLELAKDFKGQEIPYSELQVVFEKNLKTLSAVESGQMEVFESIKNIENIEEDAR 420 Streptococcus u...
A4VWI6       341 ATYLLADSKLSRINQLKARLESIEIVVTESVEDIENPQVAYSILEERLDHSLASLKEIEEEQLVLADYLKSQELSENTAR 420 Streptococcus s...
Q8DQE5       342 KTYLLPETAASHVRRIQTELESFEAAIVEVTSNQEEPTQAYSVLEENLEDLQTQLKDIEDEQISVSERLTQIEKDDINAR 421 Streptococcus p...
WP_022093723 356 DRFGL-EDWTHRFALADEQMNNLKEACALIQKELDEDKMPRVDVIHYYREFANDIEEFKGQVNDMKTKLLNASSDESRAK 434 unclassified Fi...
4UXV_A       400 ETLSNLKKTISETARLLKTSNIPGIPSHIQEMLENAHHHIQETVNQLNELPLNMEEAGAHLKQAEDIVNRASRESEELVE 479 Bacillus subtil...
BAH18095     417 HNVLHIQSKKEEVYRKLLASNLSSVPERFIIMKNEIDVEMREVHQLFNKRPMNVTQVRDKVNKVLTTMNTFESEAMEVLE 496 Macrococcus cas...
Q2FXK8       418 DNLLRVQSKKEEVYRRLLASNLTSVPERFIIMKNEIDHEVRDVNEQFSERPIHVKQLKDKVSKIVIQMNTFEDEANDVLV 497 Staphylococcus ...
CCZ23176     432 DELDNINIVLLEIKSEIRNKHLPMISESYQDYIDDSYQKADSILNFIRKRPIDLKSLSLQVDAARDVIYKLYDNVHNLIV 511 Coprobacillus s...
WP_008817344 432 KQLIKLQLIVNEIRVKMSKHRLPSVSQKYEDDLHKGEIMIKDIQVILDNSPLDVKRLNAELRSAIDYIYTLYNSVNNLVG 511 Firmicutes
EDP11281     432 KQLIKLQLIINEIRVKMLKHRLPNVSAQYEKDLCKGEDMMHDVRDILEHSPLDVTQLNAKLREAIDFIYTLYNNVNNLVG 511 Absiella dolich...
B9DRR4       421 KEADLYVTQLHMIKRFMEKRHLPGIPQDYLNVFFTTSTQLEALMDELSKGKINIEAVSRLRDVASASIANLEDYTYQVVE 500 Streptococcus u...
A4VWI6       421 KKATLYINKLHTLKRYMEKRNLPGIPAEFLTNFFRTSDHVEALIAELDYKRINIEVVNRLLENATYDMNQLEELAYLIVQ 500 Streptococcus s...
Q8DQE5       422 QKANVYVNRLHTIKRYMEKRNLPGIPQTFLKLFFTASNNTEDLMVELEQKMINIESVTRVLEIATNDMEALETETYNIVQ 501 Streptococcus p...
WP_022093723 435 KQLVKLQLILNEVRLNAATRNLPSVSSQFDEDIKQAEDMISRVQVVLSHSPLDVPTLNSDLQDAIDFVYKLYNNANNLIG 514 unclassified Fi...
4UXV_A       480 QVILIEKIIQFGNRFrSQNHILSEQLKEAERRFYA-FDYDDSYEIAAAAVEKAAPGAVEKIKADI 543 Bacillus subtilis subsp. subti...
BAH18095     497 HALYAEKLIQYGNRYrKDSSDVNKDLIEAERLFSN-NRYKRAVEVAEAAIERVEPGVTERLEQNI 560 Macrococcus caseolyticus JCSC5402
Q2FXK8       498 NAVYAEKLIQYGNRYrKDYSNVDKSLNEAERLFKN-NRYKRAIEIAEQALESVEPGVTKHIEEEV 561 Staphylococcus aureus subsp. a...
CCZ23176     512 TAEMVEDAIVFGNRYrSSFLEVNTELTKAELLYRN-GEYTKALSTAVDIIEKIKPDSYEMLVNkk 575 Coprobacillus sp. CAG:235
WP_008817344 512 MAIMVENTIVFGNRYrSSFPDIDSELTRAELCFRN-GQYTKALKIGIQCIEKMHPGAYEKLInkk 575 Firmicutes
EDP11281     512 MAIMVENTIVFGNRYrSSCPEIDSELTRCELCFRD-GQYTKALKIGIQCIEKMHPGAYEKLVNrk 575 Absiella dolichum DSM 3991
B9DRR4       501 NATLTEQLLQYSNRYrSFEAGVQNSFEIAMHLFEVeYDYQASFDEISYALETVEPGVTDRFVSSY 565 Streptococcus uberis 0140J
A4VWI6       501 NATLTEQLLQYSNRYrSFDESVQKAFNRSLSIFEKdFDYQAAFEEISFALETVEPGVTERFVRSY 565 Streptococcus suis 05ZYH33
Q8DQE5       502 YATLTEQLLQYSNRYrSFDERIQEAFNEALDIFEKeFDYHASFDKISQALEVAEPGVTNRFVTSY 566 Streptococcus pneumoniae R6
WP_022093723 515 VAVMVENAIVFGNRFrSTYPSMNTDLTRAELCFQN-GEYTRALKIAIQAIENLHPGTYEKLiark 578 unclassified Firmicutes sensu ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap