Conserved Protein Domain Family
DUF971

?
pfam06155: DUF971 
Protein of unknown function (DUF971)
This family consists of several short bacterial proteins and one sequence from Oryza sativa. The function of this family is unknown.
Statistics
?
PSSM-Id: 399276
Aligned: 173 rows
Threshold Bit Score: 59.4962
Threshold Setting Gi: 123631003
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q54GQ0           40 IKLSEKGKRLEISFenknnsdNNNNnnnnnnekseiikYSF--SSELLRIETPSVEKSk--kGSSMITSGR--------- 106 Dictyosteliu...
WP_012098615     18 eaidvvDDGVRILWp------GGPE-------------VTV--PHLRLRDFCPCAGCV----EEG---TGKkildp-ati 68  Anaeromyxoba...
Q2IFT7           19 sidvQPDHAIRIVWp------GGRE-------------TTI--TSWALRDFCPCASCV----EEG---TGKkllds-sti 69  Anaeromyxoba...
jgi:Plim_2433     9 IRAHRETGLFELKW-------PGES--------------ELfvRFFDVRCGCSCAVCVdeftGELLLDPAKi-------- 59  Planctopirus...
jgi:Plabr_3392    9 LSAHTADGELEIRWe------GSPS-------------YRV--PFRELRGLCPCANCV----NEH---TGErmffp-kda 59  Rubinisphaer...
jgi:Sinac_2296    8 IRALQSEQILELTWe------NQAA-------------VRI--PYKHLRGECPCASCR----NEW---TGElildp-sti 58  Singulisphae...
jgi:Isop_1483    13 IRALQSERVLELVWe------DGVT-------------DRL--PYRFLRGRCPCASCV----NEI---TGErvvgp-eai 63  Isosphaera p...
WP_014855847      6 IELHKQD-YLEIEWd------DGKI-------------HKY--PLKFLRDESPDAGNK----GETILWKHYapppkgpek 59  Melioribacte...
UCNUF:IALB_0962   8 ILDKS---KLYIKWd------DDTE-------------STI--GLKYLRDECPCANCK----GETILLKTYrppklnfvt 59  Ignavibacter...
WP_012329858     23 aTLSRGGLSLRLEWr------DGLA-------------ATL--PAERLRLRCRCAWCTrdrven-----------rfpea 70  Methylobacte...
Q54GQ0          107 -RDVGIIRIERVGNYAIRLVFDDLHDTGIYSWQYLF 141 Dictyostelium discoideum AX4
WP_012098615     69 pADIRPLELEAIGSYAIRIRWSDGHDTGLYTWETLR 104 Anaeromyxobacter sp. Fw109-5
Q2IFT7           70 pADIHPLEINPVGAYAIQIQWSDGHNTGLYAWPTLR 105 Anaeromyxobacter dehalogenans 2CP-C
jgi:Plim_2433    60 pAEIAPAGLDLVGQYAIRIRWNDGHNTGLYTWERLQ 95  Planctopirus limnophila DSM 3776
jgi:Plabr_3392   60 eNDVHPQKMNLVGNYAVKIAWSDGHQNGLFTWEYLR 95  Rubinisphaera brasiliensis DSM 5305
jgi:Sinac_2296   59 rPDLKLEGMEPIGNYAIRLGWNDGHSSGLYTWETLe 94  Singulisphaera acidiphila DSM 18658
jgi:Isop_1483    64 dPDVRPEGMAPVGSYAVKLVWSDGHSTGLFTWDRLR 99  Isosphaera pallida ATCC 43644
WP_014855847     60 pgmyeIESITPVGNYAIQIKWKDGYDYGIYSWEALR 95  Melioribacter roseus
UCNUF:IALB_0962  60 eGMYEIQNIEVVGGYAIQITWKDGHNTGIYSWDYLk 95  Ignavibacterium album JCM 16511
WP_012329858     71 cSGIAVTTVEPMGGYAVHIAFSDGHARGIFPWSYLR 106 Methylobacterium radiotolerans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap