2INW


Conserved Protein Domain Family
CbeA_antitoxin

?
pfam06154: CbeA_antitoxin 
CbeA_antitoxin, type IV, cytoskeleton bundling-enhancing factor A
CbeA_antitoxin is a family of cognate antitoxins to the CbtA toxins that act by inhibiting the polymerization of cytoskeletal proteins, see pfam06755. These are classified as a type IV toxin-antitoxin system. The family includes three proteins from E. coli YagB, YeeU and YfjZ, which act not by forming a complex with CbtA but through acting as antagonists to the CbtA toxicity, by stabilizing the CbtA target proteins. For example, YeeU binds directly to both MreB and FtsZ and enhances the bundling of their filaments in vitro. YeeU is also able to neutralize the toxicity caused by other MreB and FtsZ inhibitors, such as A22 [S-(3, 4-dichlorobenzyl)isothiourea] for MreB, and SulA and DicB for FtsZ. Thus CbeA, for cytoskeleton bundling-enhancing factor A, is proposed as a general name for all of these antitoxin proteins.
Statistics
?
PSSM-Id: 399275
Aligned: 9 rows
Threshold Bit Score: 181.865
Threshold Setting Gi: 118138493
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2INW_A          18 PWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDVDAYHLDQAFPLLXKQLELXLTGGELNPRHQHTVTLYAKGL 97 
Q8EGY4          11 HAWGLPRKVSPRFGARLILRGLHLDYLHDRASFVGEFPPAIKQQFVEAFPAMVKQLERLVATGEIDTTEQHCVSIEHAGF 90  Shewanella on...
AHG21514         9 PAWGLQPDITPRLGARLVQEGARLHFLADRANYIGVFTPEVADTLNQTFPTLIEQLEALLLSGELYPLHSHCVTVQHAGF 88  Chania multit...
Q32HN0          18 PWWRLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSGELNPRHQHTVTLYAKGL 97  Shigella dyse...
P37008           7 QTWGLKRDITPCFGARLVQEGHRLHFLADRAGFTGSFSEVQTLQLDEAFPHFVAHLELMLLSCELNPRYAHCVTLYRNGL 86  Escherichia c...
utah:Sant_1054  17 KHWGLKRSVTPCFGARLVQEGNRVHFLADRAGFNGAFSDNDALRLDQAFPLMLKQLELMLISSELNPRYQHCVTLYHNGL 96  Sodalis praec...
Q7NA13           7 PEWGLRYDLMPRFTARLVQEGNRLHYLADRAGITGTFNEEECHQLNAAFPHFIKQMELMLLSGELNSRDAHRVTLYHNEL 86  Photorhabdus ...
Q6D390          21 PEWGLKCAITPRFGARLVQEGNRLHYLADRASVVGTFSKTEARHLEHVFPELIKQLEHKLRASELNPRQQKCVTLHCNEW 100 Pectobacteriu...
WP_024914335     7 HEWGLQSDITPRFGTRLVQEGNRLHYLADRAGLTGSFSPEQLQKLDQAFPLFIDLLEEMLHSGELNPHQQHQVTIQLASL 86  Chania multit...
2INW_A          98 TCEADTLGSCGYVYLAVYPTP 118
Q8EGY4          91 TCEADTLGSHGYLYIAIYQTK 111 Shewanella oneidensis
AHG21514        89 TCEVDTLGSCGYVYIAVY--Q 107 Chania multitudinisentens RB-25
Q32HN0          98 TCEADTLGSCGYVYLAVYPTP 118 Shigella dysenteriae Sd197
P37008          87 TGEADTLGSHGYVYIAIL-NR 106 Escherichia coli K-12
utah:Sant_1054  97 TCEADTLGSCGYVYIAIYPEQ 117 Sodalis praecaptivus
Q7NA13          87 TCEADTLGSCGYVYIAIYPTQ 107 Photorhabdus laumondii subsp. laumondii
Q6D390         101 TCEADTLGSVGYVYIAIYPSS 121 Pectobacterium atrosepticum
WP_024914335    87 TCIADTRGSCGYVYISIYPTQ 107 Chania multitudinisentens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap