3UXI,1DE6


Conserved Protein Domain Family
RhaA

?
pfam06134: RhaA 
Click on image for an interactive view with Cn3D
L-rhamnose isomerase (RhaA)
This family consists of several bacterial L-rhamnose isomerase proteins (EC:5.3.1.14).
Statistics
?
PSSM-Id: 399262
Aligned: 5 rows
Threshold Bit Score: 823.706
Threshold Setting Gi: 20139466
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3UXI_D   7 MSMKSQFERAKIEYGQWGIDVEEALERLKQVPISIHCAQGDDVGGFELSKGELSGGIDVTGDYPGKATTPEELRMDLEKA 86  Bacillus halodurans
O05264   1 MTIKANYDSAKQAYEKWGIDVEEALRQLEQVPISIHCWQGDDIEGFEVNKGELSGGIDVTGNYPGKAQTPEELRRDLEKA 80  Bacillus subtilis sub...
Q8ESX0   1 MDVKQNYEQAKKQYEKWGVNVEDALEKLKQIPISIHCWQGDDVTGFEVNQQELSGGIDVTGNYPGKATTPEELRDDLDKA 80  Oceanobacillus iheyen...
Q8Y3I7   5 TEINKRYQVAKERYQAIGVDTEKALKTLKDIKISMHCWQGDDVKGFLNPDGELTGGIMATGNYPGAAHTPKQLRQDLEKA 84  Listeria monocytogene...
1DE6_B  10 TQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFENPEGSLTGGIQATGNYPGKARNASELRADLEQA 89  Escherichia coli
3UXI_D  87 LSLIPGKHRVNLHAIYAETDGKVVERDQLEPRHFEKWVRWAKRHGLGLDFNPTLFSHEKAKDGLTLAHPDQAIRQFWIDH 166 Bacillus halodurans
O05264  81 LSLIPGKHRVNLHAIYAETNREAVERDELKPQHFENWVKWAKNLGLGLDFNPTLFSHEKAADGLTLSHPDPDIREFWIRH 160 Bacillus subtilis sub...
Q8ESX0  81 LSLIPGMHRVNLHAIYAETNGEAVERDEIEPKHFENWVKWAKENGLGLDFNPTLFSHPKADDGLTLAHPNKEIRDFWIRH 160 Oceanobacillus iheyen...
Q8Y3I7  85 YSLIPGKHKLNLHAIYVDTD-EKVDLNEIEPKHFTPWVEWAKEQGLGLDFNPTFFSHPMFKDNYTLASPDKEVRDFWIEH 163 Listeria monocytogene...
1DE6_B  90 MRLIPGPKRLNLHAIYLESD-TPVSRDQIKPEHFKNWVEWAKANQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDH 168 Escherichia coli
3UXI_D 167 CIASRKIGEYFGKELETPCLTNIWIPDGYKDTPSDRLTPRKRLKESLDQIFAAEINEAYNLDAVESKLFGIGSESYVVGS 246 Bacillus halodurans
O05264 161 CIACRRIGEYFGKELGTPCLTNIWIPDGYKDIPSDRLTPRKRLKESLDRIFSEEISEQHNLDSIESKLFGLGSESYVVGS 240 Bacillus subtilis sub...
Q8ESX0 161 TIASRKIAAYMGKELGTSALTNIWTPDGYKDIPSDRLTPRKRLEDSLNQIFEEEIDKEYNVDAVESKLFGIGSEAYVVGS 240 Oceanobacillus iheyen...
Q8Y3I7 164 GKRSRKISEYFGKELGQTSINNFWVPDGIKDCPIDRYTPRKRLMEALDEVFAEKLDEKYTQEAVESKLFGLGAEAYTVGS 243 Listeria monocytogene...
1DE6_B 169 CKASRRVSAYFGEQLGTPSVMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLNPAHHIDAVESKLFGIGAESYTVGS 248 Escherichia coli
3UXI_D 247 HEFYLSYALKNDKLCLLDTGHYHPTETVSNKISAMLLFHDKLALHVSRPVRWDSDHVVTFDDELREIALEIVRNDALDRV 326 Bacillus halodurans
O05264 241 HEFYLAYALTNHKLCLLDTGHFHPTETVSNKISSMLLYTDKLALHVSRPVRWDSDHVVVLDDELREIALEIVRNHALEKV 320 Bacillus subtilis sub...
Q8ESX0 241 HEFYMGYALKNNKLCLLDTGHYHPTEMVSNKISSMLLYSDELALHVSRPVRWDSDHVVILDDELREIGLEIVRNDALDKV 320 Oceanobacillus iheyen...
Q8Y3I7 244 HEFYMGYGITRDKLICLDAGHFHPTEVISNKLSSLALFSKGVMLHVSRPVRWDSDHVVIMDDELIEIGRELVRNDLLGIT 323 Listeria monocytogene...
1DE6_B 249 NEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDHVVLLDDETQAIASEIVRHDLFDRV 328 Escherichia coli
3UXI_D 327 LIGLDFFDASINRIAAWTIGTRNVIKALLFAMLIPHKQLKEWQETGDYTRRLAVLEEFKTYPLGAIWNEYCERMNVPIKE 406 Bacillus halodurans
O05264 321 AIGLDFFDASINRVAAWTIGTRNMIKALLYALLLPNGYLKQLQEEGRYTERLALMEEFKTYPFGAIWDSYCEQMGVPVKE 400 Bacillus subtilis sub...
Q8ESX0 321 RIGLDFFDASINRIAAWTIGTRNMIKSLLYALLTPNEHLKQLQEEGNFTDRLAIMEELKTYPFGAIWDYYCESMNVPVGE 400 Oceanobacillus iheyen...
Q8Y3I7 324 NIGLDFFDATINRIAAWVVGTRNTQKSLLKALLEPTADLKKMELENDFTSRMAITEELKDFPFGDVWNYFCEINGVPVGL 403 Listeria monocytogene...
1DE6_B 329 HIGLDFFDASINRIAAWVIGTRNMKKALLRALLEPTAELRKLEAPGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGS 408 Escherichia coli
3UXI_D 407 EWLKEIAIYEKEVLLQR 423 Bacillus halodurans
O05264 401 AWLYDIKEYEQQVLLKR 417 Bacillus subtilis subsp. subtilis str. 168
Q8ESX0 401 SWLTEVKEYEKEVLSKR 417 Oceanobacillus iheyensis HTE831
Q8Y3I7 404 DWLKEVKAYEEDVLLKR 420 Listeria monocytogenes EGD-e
1DE6_B 409 EWLESVRAYEKEILSRR 425 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap