Conserved Protein Domain Family
Herpes_LAMP2

?
pfam06126: Herpes_LAMP2 
Herpesvirus Latent membrane protein 2
Family of Kaposi's sarcoma-associated herpesvirus (HHV8) latent membrane protein.
Statistics
?
PSSM-Id: 147993
View PSSM: pfam06126
Aligned: 2 rows
Threshold Bit Score: 766.111
Threshold Setting Gi: 81962221
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9WNA9   2 NYKKYLWGTWFAALITCCGCLSIMfCLLTinlqNTIFLLSNISVYYQLFCTITNIYVQ---SKKQRFQASPPIGpsiIVG 78  Human gammaherpesvirus 8
Q91GT6   2 KTHIFFWNLWLWALLVCFWCITLV-CVTT----NSIDTMASLLVMCILFVSAINKYTQaisSNNPKWPSSWHLG---IIA 73  Human gammaherpesvirus 8
Q9WNA9  79 CIAFASWSFSTQSTLSTVCVCIISLLSIITAILSLGGTLRVVKCTIDSGLLCIVMVLVLIFSMGLQIYNNWTHCQFFLPL 158 Human gammaherpesvirus 8
Q91GT6  74 CIVLKLWNLTTTNSVTYACLITTAILSLVTAFLALIKHCTACKLQLEHGILCTSTFAVLITNMLVHMSNTWQSSWIFFPI 153 Human gammaherpesvirus 8
Q9WNA9 159 WTLLLVFFIHIFATDNGPCLKLAACVFAICGGILKATPAFFCVSHSCLSVIIAGCISCIHIGMTGLFITMKRHWIGSTKG 238 Human gammaherpesvirus 8
Q91GT6 154 SFTLSLPFLYAFATVKTGNIKLVSSVSFICAGLVMGYPVSCCKTHTCTATAAGLSLSSIYLGFTGIITTLHKSWAPPKRG 233 Human gammaherpesvirus 8
Q9WNA9 239 LMSFLLLQGGVLVTLTTTIGILFIKREQdTNNEGSITLLAGCGFLLYCFFCWQSFHKASLSGGFLFLFLAWTCAGCCVKL 318 Human gammaherpesvirus 8
Q91GT6 234 ILTFLLLQGGVLTTQTLTTELLAITSTT-GNIKGHEILLLVCLIFLWCLYVWQSFNKASLVTGILHLIAAWSHTGGCVQL 312 Human gammaherpesvirus 8
Q9WNA9 319 VLLYTDGWTTGVTSGLICVIVILSTGQAVLVGYLYRESRLVSFNNV-TTRLPIYTPHDTPHAHAgricpdvNHLARRL-- 395 Human gammaherpesvirus 8
Q91GT6 313 VMLLPSGLTRGILTMIICISTLFSTLQGLLVFYLYKEKKVVAVNSYrQRRRRIYTRDQNLHHND-------NHLGNNVis 385 Human gammaherpesvirus 8
Q9WNA9 396 -PPLPSRNVIHSRILSSTTDmalspvRVCNTEVTTQLEMQQLHSE--RTVTYASILGDNTPPPTRASACINQSGIS--NV 470 Human gammaherpesvirus 8
Q91GT6 386 pPPLPPFFRQPVRLPSHVTD------RGRGSQPLNEVELQEVNRDppNVFGYASILVSGAEESREPSPQPDQSGMSilRV 459 Human gammaherpesvirus 8
Q9WNA9 471 SNCGVRSLD--PPPFQPADEVYEEVLFPTD 498 Human gammaherpesvirus 8
Q91GT6 460 DGGSAFRIDtaQAATQPTDDLYEEVLFPRN 489 Human gammaherpesvirus 8
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap