Conserved Protein Domain Family
TraH

?
pfam06122: TraH 
Conjugative relaxosome accessory transposon protein
The TraH protein is thought to be a relaxosome accessory component, also necessary for transfer but not for H-pilus synthesis within the conjugative transposon.
Statistics
?
PSSM-Id: 399256
Aligned: 33 rows
Threshold Bit Score: 226.444
Threshold Setting Gi: 225646798
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015279871           39 MTEMFE--TMLNYTEPTAHLGQRRGVLTGGSVNARNRIM--NESLWHVVPPSFDAGCGGIDLFAGSFSFISAEQFQNLLR 114 Thiofl...
jcvi:cds.PERMA_A0032   26 LDKIV---GSSYYLPPGEIKSPTTNTYTLGSYSFRLRNDllNRPVLSLRPPQATFSCSGADFDAGMLSMLNLNTFGDMLS 102 Persep...
calssnu:BYI23_E003350  28 LQDALDgmFMSNSTTPDSFTNQSRGGLVGGGASVRMPIR--NINLISFDPPRLSAGCGGIDLFGGAFSFINADQLVALFR 105 Burkho...
jgi:Mpe_B0375          27 LQDALDgmFMSNSTAPQAFSSQSRGGFVGGSVAMRTPVR--NINLVAFDPPRLAAGCGGIDMFGGSFSFINADQLVALFR 104 Methyl...
jgi:Thein_1941         26 VEDWLNn-SVTSYTGPSYIEAGRRGYLSFGSVSTRTLMT--TDRLITFTPPSINFGCGGIDIFMGGFSFLDFDYLVDKFQ 102 Thermo...
BAI99074               17 aESWF---DNVTYTSPGSFEDQTRGYLTAGGMSGRVDVH--NDYLMSLSLPKVKAGCGGIDMFLGGMSFLDPDYLVQKLE 91  Sphing...
jgi:Despr_0153         23 vDDWL---QQQATTSPDYLSGQQRGYYAGGSFSGRWRST--AEYPVTVEMPRIKSGCGGIDVFMGGFSFMNTDYLVDKLQ 97  Desulf...
WP_013681680           26 vSDWV---QQKTSLAPNYFKGQKRGYFTFGSFSARWQPSq-TTYLFDIQKPSLKIGCGGIDIFGGGFNFVNPQYLVQQLQ 101 Hippea...
Q2LU06                 35 VDDWL---QQKTETSPGYFEGQKRGYFTGGSFSARWQQG--NDYLFTAMPPKVKAGCGGIDVFLGGFSYLNFEYLVTKLQ 109 Syntro...
jgi:Glov_0253          44 VDDWV---QQKSSTSPSYYEGSKRGYYTGGSFSARWANT--DDHLFTASLPKLKSGCGGIDMFLGGFSFLNVDYLVQKLQ 118 Geobac...
WP_015279871          115 AIAANATGYAFEVALGAMCKECLETMETLQKKVQALNQGFANSCQLAKGLVNdvADAFDMKHKDNTSL------LGMVKG 188 Thiofl...
jcvi:cds.PERMA_A0032  103 QAGTSV-AWGIMIGLVYSLPGIGDAFQKLNEWARMFQQLISNSCMIGTQIGK--NLGSSIWESGRTNAqg----kGVASG 175 Persep...
calssnu:BYI23_E003350 106 QIAANAVGVAFKAAIDAINPALGKLMQDFQNKIAALNSMMKNTCALATTIMDktGVSGAIRSFVDENVss---eTGSKSG 182 Burkho...
jgi:Mpe_B0375         105 QIAANSVGLAFKAAIDYINPALGKQMQEFQAKMQALNENMRNTCAIANQVVKsfSDPSARKDMVDGATaa---aEAAKGG 181 Methyl...
jgi:Thein_1941        103 RIISAAPAFAFEYALRSICEQCGTIVDAMNAAQDLLNSLQLNDCQASRWLGY--YLASKA-GFNPEAQkektktEASKLA 179 Thermo...
BAI99074               92 SILQAAPAVAFQYLLETLDEKMGNIISKMEAATNFLNSIQVNDCRLANRMVQ--------IAKGDDNMsgiieeMTGYRS 163 Sphing...
jgi:Despr_0153         98 AILTNASAVAFDLALKTLCEQCSNTIKNFEALADKLNSMQIDECAAAKELVG--IVADGNGFHSTEVMrerlgtAIKENK 175 Desulf...
WP_013681680          102 TMLQAAPAVAFDIALKTLCEQCSQTIKSIEGMIQRLNGLQFNACKASKIMLT-----KVVDAISPDSQsserasADQSHN 176 Hippea...
Q2LU06                110 RIMQAAPAAAFDIALNVLCEPCSKTIKSLEAITNTLNNLQLDECKAGRALVA--TMVPPSLAETKDKqak-lagIQGDFL 186 Syntro...
jgi:Glov_0253         119 NILSAAPAAAFDIALKTLAPQVADTIKSLEAITDRLNSLQMNDCKAAKALVA--TAASPFSSVMSDSLkaemktAQTDFM 196 Geobac...
WP_015279871          189 L-GDVFETRSSASG-AdpiAQVRDNVPP---------------------------Eert-qieGNLVWQALKRKGAAgwf 238 Thiofl...
jcvi:cds.PERMA_A0032  176 SvSSFEAAQKE--------FIDLIKTTGeik-----------------------------kffGTIPYGPLYEGGWT--- 215 Persep...
calssnu:BYI23_E003350 183 MlTDMFS------------GIDSFLSNAntvtrnvq-------------------ksgkepelGNLTWMALNTTQAGqml 231 Burkho...
jgi:Mpe_B0375         182 f-DDLWS------------GMTSFFTTPnsatrtad-------------------aggycaecGNPVWKALVSSNSGvll 229 Methyl...
jgi:Thein_1941        180 TlAGTVRSWKDWl-----dQHLKTVAVPgqlsstenqeln----rdcpsyindllNs------GSLIHYVYQTRFST--- 241 Thermo...
BAI99074              164 VkQGFAKSYQQSRE-----KIQANNNNPtedlkdalen--------cpaevtdifRt------GSLLSHAASRVGAA--- 221 Sphing...
jgi:Despr_0153        176 LvSGTAEMWDILTKe---dRANNNQPKPadlaavtsg---------cnadiraifLs-----gGSLLANVGSRLSIPt-- 236 Desulf...
WP_013681680          177 VlTGAVDLFNEIFEs---eQSITPSSKPsvnqpasaqtdydkmiadcpqdikdifAasqdnpnTTILEGMAKKLNIPe-- 251 Hippea...
Q2LU06                187 QsSGVNDLWKSIn-----dQTSANANKPvtnmkqalag--------cpqdirdvfGt-----sGSVINNIAAKTGFNn-- 246 Syntro...
jgi:Glov_0253         197 VsSGAKDLYQDVSKlFeseQKTNAGNKPgvpgttqtsatsa--tagcptevlqvfGd------GSVLENLAGKKGMSs-- 266 Geobac...
WP_015279871          239 aDGDDT-------LLEAMMSLTGSVIVga----pEAAPdgqg-------dnhrITYL--PGNlLK-----ASDLLNGtr- 292 Thiofl...
jcvi:cds.PERMA_A0032  216 ---DTE-------TADLVASLFGVLEWr------AVDTagndctdtsclknakIKVVyyPPL-TNn----LQDIING--- 271 Persep...
calssnu:BYI23_E003350 232 gNPQTGetd-angANEIVMSLIGTVVNgpenssdTTASdgsvavdngrywaptIR---------------LLDLKDGnm- 294 Burkho...
jgi:Mpe_B0375         230 gDPTTStdsnanrTNEIIMSLMGTVIMstt-kadTTTTggvtqkdtgtvkpylLT---------------LFDLRDGss- 292 Methyl...
jgi:Thein_1941        242 --YGQE-------LEAVLRGYLGDVVF-------Yqnng-----------rwmVNVI--PGCgSKnvsnpLEVLITGktl 292 Thermo...
BAI99074              222 -----D-------WAEVMRARVGDVYM-------RWDPndk---------vplFSAI--PAC-PRqdtesPDDFLSG--- 267 Sphing...
jgi:Despr_0153        237 -----S-------HVNLLRGLVGDIQL-------EGAAng-----------yrVATI--PPC-AQnnpddLEAFTDGev- 282 Desulf...
WP_013681680          252 -----D-------YVDLIRGFVGDIRI-------VVAQnsqg--------kkeLKIVlmGPC-AKndstkTNEFYNGta- 302 Hippea...
Q2LU06                247 ----qS-------YLDMLRGFVGDVYI-------IDAGdag----------fqVGHT--PPC-DQnryasFDNLLDGsv- 294 Syntro...
jgi:Glov_0253         267 -----E-------YVKLVRGFIGDVII-------QNPAttgt--------tyqAQYI--PPC-DKnn--sFDSFISGsa- 313 Geobac...
WP_015279871          293 -------dREdaaqwdnawsHRVrlYQCGPpggpiDrSENGCLEPS--VTEDAVNGMIQRVRDVLigvrpy--gagtetI 361 Thiofl...
jcvi:cds.PERMA_A0032  272 --------------------ATMqiYHCNWgy-dtNiGTFKCNGGVevSNKDIPEGLRQKIVNRI--------------D 316 Persep...
calssnu:BYI23_E003350 295 -------sGN----------KPMyaLRCAD-----GyDLNKCMKIS--KQNLSFGGVSGYVNLMLfgdaag---rsistD 347 Burkho...
jgi:Mpe_B0375         293 -------sG-----------KPFkiWTCSD-----GyAKHQCTQLT--ETAVTFDGMKGYVNKMLfgyadglasgvptaG 347 Methyl...
jgi:Thein_1941        293 vnplktspSSpl---------------------diTlGTQQCTEYQ--SFFPNAKPLIDIIKDTL--------------E 335 Thermo...
BAI99074              268 --------------------------RVQRrvlniPaTGADCSN-------DGGKGALELARTRM--------------D 300 Sphing...
jgi:Despr_0153        283 ---------------------------------yaKsATGGCSRIT-----DAGRDLVESVTSKL--------------N 310 Desulf...
WP_013681680          303 ---------------------------------yaEnDTGECYS-------ANTKNLIQYVQDNM--------------Y 328 Hippea...
Q2LU06                295 ---------------------------------yaRtAGGACAQIT-----DSSADLTNYVRTKM--------------T 322 Syntro...
jgi:Glov_0253         314 ---------------------------------qgRdTAGACADIT-----DANKNLMVYVAGKM--------------Q 341 Geobac...
WP_015279871          362 GLVQKFrL----GQGAITA--AEQAFM-QYAPNG----LGAGIRTLARY-DegmARLFVEQAAPVIALEMTQVILND 426 Thioflavi...
jcvi:cds.PERMA_A0032  317 GIVDDI------IDGTFMAnpDDAQWI-KSVPLPnfpeVINYLAILKKQgFtsqYNSALYGVSELISSMMLKVLIDN 386 Persephon...
calssnu:BYI23_E003350 348 SIVGKL-VscsgNACDFTS--AQKTFI-GNISAP----VLGLMKKVQSMpg--aAAQMAVLTAPIVTDELTLKYAEs 414 Burkholde...
jgi:Mpe_B0375         348 SIIGKL-EscstTSCGFTQ--AQKDFL-NSVQTP----TLALVRKVQAVpg--aSQHVATRLVDQIANEIAVKYGEa 414 Methylibi...
jgi:Thein_1941        336 SAYIKT-I----NHQALTP--TEMNLM-AMLPAP----VYNYIKQLYIYd---aPTFALTHISDIAAEGFAYTLLTm 397 Thermodes...
BAI99074              301 SIATKI-R----TRAALTA--EERQFVaNVSTLP----VYRMLEWGVRQg---vAGSVIGDTDELVALTLAYQMLND 363 Sphingobi...
jgi:Despr_0153        311 TIADKL-A----AKGSLSA--VEQTFI-EGNPLA----PLPILKTAVGTg---tRDAVIPGLADITAKAYSLQMLSD 372 Desulfobu...
WP_013681680          329 KIIQKM-KdsdgSNRALSD--EEQSII-QTSPVS----VYQALKASVIVg---dTDTVASLLSDITAKAYAYGALSD 394 Hippea ma...
Q2LU06                323 RIAGKI-K----AKQALSD--EDNAFV-NASPLS----IGLVLKAAVGTn---qESSIISTLSDVTAKAYAFQLLSD 384 Syntrophu...
jgi:Glov_0253         342 SIATKI-K----SKTALTA--DEEAFL-KSTPLS----VGLILKNATATn---tEGEVIGKLAELTARAYGYYMLLD 403 Geobacter...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap