Conserved Protein Domain Family
DUF959

?
pfam06121: DUF959 
Domain of Unknown Function (DUF959)
This N-terminal domain is not expressed in the 'Short' isoform of Collagen A.
Statistics
?
PSSM-Id: 399255
Aligned: 2 rows
Threshold Bit Score: 298.667
Threshold Setting Gi: 1562469524
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_027778062   15 LLTCCLVPSWANLLTLDWLWSTDITDSEDTLVSQPQGSLPVQPAAAPATHVAPQDDPAEQRTAPASPRPPLENPKAAPSR 94   yellow-bellie...
XP_023396792   13 LLTCCLAAAHAHILGLSLPWFLRSADPTMTLASEPRKGSAVQPTADPTTHVAPQEGPTEQATAAAVRELPLEELEAGQGR 92   African savan...
XP_027778062   95 APGAPisaaapAAPAASPDTREENVAGVGAKILSIAQGIQSIVQLWNEATPTQSSAGS----ASAPTDPLALAGPSGPPE 170  yellow-bellie...
XP_023396792   93 APTAP------VALAQRPDMREENVAGVGAKVLNVAQGIRSFIRLWNDAAPTESPTGAgtlaPVVPTDPLTLPESSSTAA 166  African savan...
XP_027778062  171 ESGTTLGPHRGALSSLGTWTAESGTLAVPTQS 202  yellow-bellied marmot
XP_023396792  167 GSRTAPGPSSTASSSQDTPRTHSSTLPVPTQL 198  African savanna elephant
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap