Conserved Protein Domain Family
Phage_HK97_TLTM

?
pfam06120: Phage_HK97_TLTM 
Tail length tape measure protein
This family consists of the tail length tape measure protein from bacteriophage HK97 and related sequences from Escherichia coli O157:H7.
Statistics
?
PSSM-Id: 399254
Aligned: 3 rows
Threshold Bit Score: 327.024
Threshold Setting Gi: 502752792
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCH:MU9_2654  401 TSVGSRLLGGALGLVGGIPGLVMLGAGAWYTMYQKQEQARQSALEYAATIDQVRANLNKMTLPETADNSGKTKESLAAQN 480  Morganella mo...
WP_012987776  409 ASVGLRLLGSAFAFVGGWFGLITIAAGVFYYMYEKTKQASDGAREYAKNLGDVKEKLKDLSVEEVAAEIDKMNKSIKQMG 488  Xenorhabdus b...
WP_012988517  416 TSLGSRMGGALLGAVGGLPGILIMAAGAAYLLYQNQKQAKEEARAHAKEATKIKEELSKMDPVQLRDTKNQLKEDLAV-- 493  Xenorhabdus b...
CCH:MU9_2654  481 KLVDEQRQKVEGLKSAIAGYQqmlaspgpsingylinhlISQEDAVKsLAAAQDELSVEQSRLNELSKKSEEIQSALKAV 560  Morganella mo...
WP_012987776  489 IDAKNAEQKIDELQKELDKFK------------------DPKKRAIK-IAYYTSNGLDSDFAEQAVTDDEKQAQEALTQA 549  Xenorhabdus b...
WP_012988517  494 -----AKEDVEKFRKEMNKNQislnlf-------mkdksNGKNTDIK-ITEFSTKLSESRSAYEAALKTVGEITSALTS- 559  Xenorhabdus b...
CCH:MU9_2654  561 ESQRDFLIRQqsaaqnnmrhsllmVNAEHSEFNRIMSAGNQILTNRLAL-------------VNSPMRIPAA-------- 619  Morganella mo...
WP_012987776  550 KADHVRITRE--------------LNNAKANSAKMSDIGNKKIAETNKLiye-------qgkKEIPNNVKEWenagktyg 608  Xenorhabdus b...
WP_012988517  560 ------LGDQqtingekekrfitaINEMRKTGNVTLALQNQKLELTVSLleriknlgidvsgIHVPVPVVKF-------- 625  Xenorhabdus b...
CCH:MU9_2654  620 -------------------------PLSEKQQDFIQKSERDKELSALTGE-ARVIRQAEFAADDIGLLnkpefADNRQ-- 671  Morganella mo...
WP_012987776  609 evvdlikvklsslgiaiksvgedtkEVNKKMEGMIKNAERDLEIASIPDEkGKLIKEAEFEAKDAGAN-----SGDTE-- 681  Xenorhabdus b...
WP_012988517  626 -------------------------EPNDKIKSLLKDQEREIDLSKRKGL-DKVRREAYYKAVDGGLN-----PDDRQqk 674  Xenorhabdus b...
CCH:MU9_2654  672 ----KYIDNQVAAYRNQEKLS 688  Morganella morganii subsp. morganii KT
WP_012987776  682 ----KYVNLVVKKQEVDEAAE 698  Xenorhabdus bovienii
WP_012988517  675 pyvnQVINNAAQVYQNAEAlr 695  Xenorhabdus bovienii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap