Conserved Protein Domain Family
DUF956

?
pfam06115: DUF956 
Domain of unknown function (DUF956)
Family of bacterial sequences with undetermined function.
Statistics
?
PSSM-Id: 399251
Aligned: 43 rows
Threshold Bit Score: 144.285
Threshold Setting Gi: 81537609
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9CEX5          1 MAQSLNTKADYSTEGIAYLG-FAEYGKILIGDVAFEF-YNDRNVEKNMTFPWTAVARVEGDVSkslkGEVKVGRQFSIVL 78  Lactococcus la...
Q9CEX3          5 LATN-NSEIFYETKGTAYLG-VVENGKIILGDAGFEFeYKNPRRGQNIFFTWSSIKSAEVDVS----ISGKLGQQFSLIL 78  Lactococcus la...
Q8DSB9          1 MAQSINTKVEYTGKGVSYLGvGGKVGKFLLGDRSFEF-YNDANVEHFIQIPWSSIIEIGANVN----RK-KVSRHFEIIT 74  Streptococcus ...
Q99YE3          1 MAQSLNTSVEYKTKAVSYLGmGGKVGHILLGDKALEF-YNDKNVNDYIQIPWTAINHIGANVS----RK-KVSRHFEIFT 74  Streptococcus ...
Q8E1J6          1 MAQSLNKTVEFQTTGVSYLGmGNKVGKFLVGDQALEF-YNDKNVNDYIQIPWTSINQIGANVS----RK-KISRHFEVFT 74  Streptococcus ...
Q8DR21          1 MAQSLNKTVLLSTTGTSYLSiAGKVGKFLVGDQALEF-YPDVNVEQFIQIPWSHINQIGANVT----GR-KISRHFEVFT 74  Streptococcus ...
bgi:05SSU1781   1 MAQSQNTSVELQTTGVSYMGfGGKVGKFLIGDKALEF-YPDSNVERYIQIPWSEMTSIGANVS----GK-AISRHFEIYT 74  Streptococcus ...
CAR43190        1 MAKSMNTTVDFQTKATSYLGmGGKVGKILVGDKAFEF-YNDKNVEDYIQIPWSSINQIGANVS----RN-KVSRHFEIFT 74  Streptococcus ...
WP_006845809    1 MVESINTRVELKAPGISYLGiGAKYGDFLIGDNGFEF-FNTNNVNDFIQIPWEEMKVVYAQLH----YNKKLGRRFKVIT 75  Weissella kore...
Q03VC0          1 MVQSLNAKAEYTTQGISYLGiGAKYGKILVGDQAFEF-FNDNNVEDYIQIPWKNISAVYVHVT----GN-RVSRRFKIKT 74  Leuconostoc me...
Q9CEX5         79 QNGSKVRFSSKNSGTVLKWIRHYLGNDKVVKSPSFLGTFKNAF 121 Lactococcus lactis subsp. lactis
Q9CEX3         79 DTQAKVRFSSKDSGSILKKVAEYVGKENIVRAPSLLDPFRRAF 121 Lactococcus lactis subsp. lactis
Q8DSB9         75 DK-GKFLFASSDSGKILKIARQHVGNDKVVRYPSLLQKIASFF 116 Streptococcus mutans
Q99YE3         75 DQ-GKFLFASGDSGKILKITRQHIGNEKVITLPTLMQTFINKF 116 Streptococcus pyogenes serotype M1
Q8E1J6         75 DQ-GKFLFASKDSGTILKHARRHIGDDKVVKLPTLIQTILKIF 116 Streptococcus agalactiae serogroup V
Q8DR21         75 DK-GKFLFASKDSGAILKIAREKLGNDKVVKLPTLIQTISQKF 116 Streptococcus pneumoniae R6
bgi:05SSU1781  75 EK-SRFLFASKDSGKILKIAREHIGNEKVVKLPTLMQTIGRKI 116 Streptococcus suis 05ZYH33
CAR43190       75 DQ-GKFLFASKDSGKILKLARLKIGNEKVVRLPTLIQLMISkw 116 Streptococcus uberis 0140J
WP_006845809   76 SI-GDLDFSSKEVGAVLKTIRQHIGNEKVLRRQSFWKQMTLTF 117 Weissella koreensis
Q03VC0         75 DK-IDLDFSAKSSGSLLKVMREHLGNDKILRTASLWDTIRSRF 116 Leuconostoc mesenteroides subsp. mesenteroides ATCC...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap