6GVW


Conserved Protein Domain Family
BRE

?
pfam06113: BRE 
Brain and reproductive organ-expressed protein (BRE)
This family consists of several eukaryotic brain and reproductive organ-expressed (BRE) proteins. BRE is a putative stress-modulating gene, found able to down-regulate TNF-alpha-induced-NF-kappaB activation upon over expression. A total of six isoforms are produced by alternative splicing predominantly at either end of the gene.Compared to normal cells, immortalised human cell lines uniformly express higher levels of BRE. Peripheral blood monocytes respond to LPS by down-regulating the expression of all the BRE isoforms.It is thought that the function of BRE and its isoforms is to regulate peroxisomal activities.
Statistics
?
PSSM-Id: 399249
Aligned: 7 rows
Threshold Bit Score: 459.211
Threshold Setting Gi: 1209701484
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6GVW_C        12 NRISPMLSPFISSVVRNGKVGLDATNcLRITDLKSGCTslt--pgPNCDRFKLHIPYAGETLKWDIIFNAQYPELPPDFI 89 
OWR52447      10 NEISPMFRPYIQSIYQDLKLGLCKAK-VDLERIGGNSS-------GAESQFRLVLPYCSKKLKWDVIFDTSTPWFAPDFR 81  Danaus plexippu...
B6NXD5         9 KQLHPLIRPYAETVLRKGNVGVCMGN-LRISDVKSGRPtltqtkePCGDRFKIYIPFAGDSLKWEVIFDSCQPSNPPDFI 87  Florida lancelet
EFN65095      10 STIDSYIEPLLKRVLQTKRLGVCCGL-IKLDSVSSSCNk------SKNDCFKLSIPYAGEHLVWSVLFDSQYPEMGPDFI 82  Florida carpent...
EFN76708      13 NTIDPYTEPLLKRVLHSKRLGISYGG-VKLNKGPTSCNk------SSNDCYKLTIPYAYENLLWTVLFDSQYPEIGPDFI 85  Jerdon's jumpin...
XP_012062756  10 sTIDSYIEPLLKRVLQTKRLGVSYGP-IKLDSVSSSCNk------NKNDCFKLLIPYAGEHLMWNVLFNSQYPEMGPDFI 82  Atta cephalotes
XP_850681      8 NRISPMLSPFISSVVRNGKVGLDATNcLRITDLKSGCTslt--pgPNCDRFKLHIPYAGETLKWDIIFNAQYPELPPDFI 85  dog
6GVW_C        90 F-GEDAEFLPDPSALH----NLASWNPSNPECLLLVVKELVQQYHQFQCGRL-RES-SRLMFEYQTLLEEPQYG-ENMEI 161
OWR52447      82 FdDDSFLSSANEDYLTksvpSLTNWDANNPKSLGDVLSELIKLYKIHQVRKLhEDAnSRASFEYSALMGNALTTeKDVEV 161 Danaus plexippu...
B6NXD5        88 FlGENGNFDPDIEKLE----NLTHWDPKNPESLVLAIEDLMREYRCYQKQLI--EGySRLQFEYSSLQGMEAC--DDVEV 159 Florida lancelet
EFN65095      83 FnDQSFLADPDINTLStwipSLTKWNPNDIDALLNVLSELLLYYKEHQLHLLgKQG-DRLQFEYSTLVGETEISrEDIEV 161 Florida carpent...
EFN76708      86 FnDQTFLMDPDIDILStkvpSLVKWDPTDSDALLNVLVELLLYYKEHQIESLaQQG-DRLQFEYSTLVGNTELHvDDIEV 164 Jerdon's jumpin...
XP_012062756  83 FnDQNFLMDPDIDILStwvpSLVKWNPNNTDALLNVLMELLLYYKEHQILLLgKQG-DRLQLEYSTLVGETEICkEDIEV 161 Atta cephalotes
XP_850681     86 F-GEDAEFLPDPSALH----NLASWNPSNPECLLLVVKELVQQYHQYQCSRL-RES-SRLMFEYQTLLEEPQYG-ENMEI 157 dog
6GVW_C       162 Y---AGKKnnwtgefSARFLLKLPVDFSNIPTYLLKDvneDPGEDVALLSVSFEDTeatqVYPKLYLSPRIEHALGgssA 238
OWR52447     162 W---VGGH-------IVEFLIKLKVDVLRLPELYNDGteqNPGIDTALLLVRYPNS----TNAELILSPFLTKVLG---K 224 Danaus plexippu...
B6NXD5       160 H---MGNRlpgtldsPVNFLIRLPIDLSPIPQYLVKD---DPGEDLAVLLAKFHNSegsrVTPQLFLSPKVEHALGdntA 233 Florida lancelet
EFN65095     162 ImlpLGTKp-----tEARFLIRIVMDYSRLPPRINKS-----QNDEAMLIIMFYGPdwnrIIPQLYLSKTLEDIFGgpeS 231 Florida carpent...
EFN76708     165 IllpLGGKp-----vEARFLIRISMDCC-LPPCVDKL-----HDNETMLHITFYGPdwnrIIPKLYLSKTLEKAFGgpdS 233 Jerdon's jumpin...
XP_012062756 162 Mv-lLGLKp-----mEARFLIRISMDYTRLPPRINKS-----QNDEAMLLVTFYGPdwnrISPQLYLSKTLEDAIGrpeS 230 Atta cephalotes
XP_850681    158 Y---AGKKnnwtgefSARFLLKLPVDFSNIPTYLLKDvneDPGEDVALLSVSFEDTeatqVYPKLYLSPRIEHALGgssA 234 dog
6GVW_C       239 LHIPAFPG-GGCLIDYVPQVCHLLTNKVQYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGftkLTLLLMWKDFCFLVHID 317
OWR52447     225 ITLPMMHH-SGVLMDYVPLVTEILNNKIYHLLNNDKLKRDLLAQLIVKYEGAILEHDASS---AALLLQMNDFYWILQVD 300 Danaus plexippu...
B6NXD5       234 LRIPRFPT-GGCLMDYVPQVQDFLQKQIDHIVEGYQRRREYVAAFISRFGGSVLEYDAESftkLSLVLEWNEFFFVLHIE 312 Florida lancelet
EFN65095     232 LHIPPFPS-SKYLMDYVPEVKKFIDEKIHNVVQSFESRKSFITVLIVSQRGSILEYDAIEfnwISMLLEHRDFHFLIHFH 310 Florida carpent...
EFN76708     234 LHLPPFPPtTKYLMDYVPEVKKYIEEKINAVVECFEKRKDFLAALLMIQSCSLLEYDTKEfdyCTIMLEQLDFHVLVHFY 313 Jerdon's jumpin...
XP_012062756 231 LHIPPLPP-NKYLMDYVPEVIKFMEEKINSAIQCFENRKEFIVFLLVLQRGSIVEYDAIEfnwIIILLEHRDFHFLIHFN 309 Atta cephalotes
XP_850681    235 LHIPAFPG-GGCLIDYVPQVCHLLTNKVQYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGftkLTLLLMWKDFCFLVHID 313 dog
6GVW_C       318 LPLFFPRDQPTLTFQSVYH 336
OWR52447     301 IGIKFPEKPPVLTLRSVYY 319 Danaus plexippus plexippus
B6NXD5       313 LPSRFPQDMPVFTFQSCYH 331 Florida lancelet
EFN65095     311 LPSTFPKEKPQITLQSVYH 329 Florida carpenter ant
EFN76708     314 LPPGFPKESPQITLYSVYH 332 Jerdon's jumping ant
XP_012062756 310 LPSIFPKEKPQITLQSVYH 328 Atta cephalotes
XP_850681    314 LPLFFPRDQPTLTFQSVYH 332 dog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap