2KCD


Conserved Protein Domain Family
SAUGI

?
pfam06106: SAUGI 
Click on image for an interactive view with Cn3D
S. aureus uracil DNA glycosylase inhibitor
Uracil-DNA glycosylase inhibitors, are DNA mimic proteins that prevent the DNA binding sites of UDGs (Uracil DNA glycosylase) from interacting with their DNA substrate. SSP0047 (SAUGI; for Staphylococcus aureus uracil-DNA glycosylase inhibitor) acts as a uracil-DNA glycosylase inhibitor that breaks the uracil-removing activity of S. aureus uracil-DNA glycosylase (SAUDG) pfam03167. The SAUGI/SAUDG complex has been determined, and shows that SAUGI binds to the SAUDG DNA binding region via several strong interactions, by using a hydrophobic pocket to hold SAUDG's protruding residue (i.e. SAUDG Leu184, E. coli UDG Leu191 and B. subtilis UDG Phe191). By binding to SAUDG in this way, SAUGI thus prevents SAUDG from binding to its DNA substrate and performing DNA repair activity.
Statistics
?
PSSM-Id: 399243
Aligned: 2 rows
Threshold Bit Score: 167.062
Threshold Setting Gi: 365223624
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2KCD_A     1 MTLELQLKHYITNLFNLPRDEKWECESIEEVADDILPDQYVRLGPLSNKILQTNTYYSDTLHKSNIYPFILYYQKQLIAI 80  Staphylococcus sapr...
EHM64904   2 KTTTQELKQYITRLFQLSNNETWECEALEEAAENILPTRFVNHTPLAHLTLDTYTYYNDELHELSIYPFLMYANNQLISI 81  Staphylococcus pett...
2KCD_A    81 GFIDeNHDMDFLYLHNTVMPLLDQRYLLTGGQ 112 Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC...
EHM64904  82 GYLD-HFDMDFLYLTDTKNTIIDERHLLREGG 112 Staphylococcus pettenkoferi VCU012
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap