Conserved Protein Domain Family
Vps62

?
pfam06101: Vps62 
Vacuolar protein sorting-associated protein 62
Vps62 is a vacuolar protein sorting (VPS) protein required for cytoplasm to vacuole targeting of proteins.
Statistics
?
PSSM-Id: 399239
Aligned: 38 rows
Threshold Bit Score: 883.485
Threshold Setting Gi: 685353451
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KQK13488      14 PEPFSFAEPL--PTWPQGNG-FARGRMCVggG-ELELAAA----TSFERICTLspSPRRDCKSSVTFYRPLAVPEGFSVL 85  stiff brome
Q9S7Q5        59 ETSFKFPSPL--PSMPSDGGnFGKRSIDM--G-GLEVTQIsisnSTSHRVWRT--YEGGPDNMGVSIFEPTTIPRNFFKL 131 thale cress
Q9SGI4        55 ETAFTFPSAL--PVIPSGGGnFGKGRIDL--G-GLEVIQVsistSTSQRVWRT--YEGGPDNMGLSIFQPINLPPSFSTL 127 thale cress
KRH07720      29 DTIFKLPVPVanSSWPQGGN-FASGIIDL--G-GLQVSQI----STFNKVWGT--YGGGPDNQGFTMFEASGIPQGFFML 98  soybean
KRH13778      16 DTTFKLPANI--PVWPQGGG-FATGTINI--G-GLKLFQI----STFNKVWKT--LEGGPGDAGAAFFEPAGIPEGFFTL 83  soybean
EEF38775      20 ETSFKLPSSL--PKWPPGEG-FGNGTIDL--G-GLQVCQI----SSLNKVWST--QEGGPDNVGASFFEPSQIPQGFFML 87  castor bean
XP_015161606  27 DDAFCLPSPL--PTWPSGGC-FASGFIDL--G-GLQVSQI----SSLTKVWST--HEGGPDNLGATFFEPSNIPNGFFMF 94  potato
XP_004229552  18 DTPFKFPSPL--PTWPSGEG-FASGIIDL--G-GLQVSQI----SSFTKIWAS--QEGGPDNLGATIFEPSNLPNDFFML 85  tomato
XP_006364462  18 DTIFKFPSPL--PNWPPGTGdFGSGYIDL--G-GLKVCQI----VTFNKVWAI--DKGGPENLGATFYEPSPIPDGFSMF 86  potato
XP_002269745  54 ETSFKLPAPM--PTWPPGEG-FAGGTIDL--GgGLEVCQI----SSFTKVWAT--HEGGPDNLGATFFEPSPMPEEFCML 122 wine grape
KQK13488      86 GHYCQPDSRPLHGHLLVAKASARAHHPprstQPPLCAPRDYELLWAFHASGGSAaagggrssssssgygrsdAYFWLPVP 165 stiff brome
Q9S7Q5       132 GFYAQPNNRQLFGWILVAKDVS---------GSNLRPPVDYTEVGNTTTLLIKQeg---------------pAYFWQPLC 187 thale cress
Q9SGI4       128 GFYGQPNNRLLFGWVLAARDVS---------GNSLRPPVDYIQVINTTSMNINQeg---------------aAFFWQPLC 183 thale cress
KRH07720      99 GSYCQPNNKPLFGWVLVAKDVSKSTS-----NPTLKQPIDYTLVWNSASMKINQdg---------------pIYVWLPTA 158 soybean
KRH13778      84 GHYSQPNNKPLFGSILVAKDETSSGDN----NGALKKPIDYTLVWSSKSQKIKQdk---------------dGYIWLPTA 144 soybean
EEF38775      88 GCYCQSNSRPLYGWVLAGKDDA---------GGALEKPIDYTLVWSSESLKIKQds---------------iGYIWLPTA 143 castor bean
XP_015161606  95 GSYTQTNNIPLFGWTLAGRDTS---------RGTLKMPTDYTLVWSSHNLKIKQdg---------------vGYIWLPIP 150 potato
XP_004229552  86 GSYSQPNNLPLFGWVLVGKDSS---------GDALKLPNDYTLVWSSENLKIKQdg---------------vCYMWLPIP 141 tomato
XP_006364462  87 GCYCQPNNKPLFGWVLAGKDNV---------GEILKNPIDYTLVWSSESSKFKNtst------------ndhGYIWLPIP 145 potato
XP_002269745 123 GCYSQPNKKPLFGWVLAGKDNTNNPL-----GGALKKPIDYTLVWSSESLKIKQdg---------------nGYVWLPTP 182 wine grape
KQK13488     166 PEGYRALGFLVTADPGKP--PLKDAGCVRTDLTDECEPHGSLLHLqltrpSSSSPGEAFAVRGVRPLRRGMSEKGIGAGT 243 stiff brome
Q9S7Q5       188 PNGYHAVGLYVTTSPMKPslGQNSISCVRSDLTEQSEADTWVWR-----------IKDMTISSLRPATRGVEATGVFTGT 256 thale cress
Q9SGI4       184 PNGYQAVGLYVTTSPIKPslSQESISCVRSDLTEQSETDTWVWG-----------TEEMTLSSLRPANRGTEATGVHTGT 252 thale cress
KRH07720     159 PDGYKALGHVVTTTPNKP--SFDKIRCVRLDLTDQCETSLLIWE-----------SGSFNVYDVRPSNRGIQAPGVRVGT 225 soybean
KRH13778     145 PDGYKTLGHVVTTTPEKP--SLDKIRCVRSDLTDQCERSSWIWGP-----DKSSDEKGFNVYEVRPSNRGTQAPGVLVGT 217 soybean
EEF38775     144 PDGYRAVGLVVTSSPEKP--SLDKMRCVRSDLTDQCEKDIWVWGP-----EKQSDPNGFNVFSLRPSNRGTQAMGVCVGT 216 castor bean
XP_015161606 151 PEGYKAIGHVVTTSPQKP--SLDKVRCVRDDLTDVCESHDWIWG-----------TNGLNVYSSRPRDRGVRALGVATGA 217 potato
XP_004229552 142 PEGYKSVGHVVTTSPQKP--SLDKIRCVRADLTDVSETDDWIWG-----------NDGFNVYSSRPKDRGIKGLGVSTGA 208 tomato
XP_006364462 146 PEGYKALGHGVTTSPEKP--ALDKIQCVRSDLTDDLEVESWVWGQ-----GTTSKVNGINVHSVRPRERGVKAQGVSVGT 218 potato
XP_002269745 183 PDGYKAVGHVITNLPEKP--SLDKIRCVRSDLTDLCEADTWIWGL-----DKVANANGFNVYDLQPSDRGAQALAVSVGT 255 wine grape
KQK13488     244 F-CCAvvGGCSTLr--EQGLACLNNVELDL-SAMPTLEQLHAVIQHYGPTVFFHPKEVYLPSSVSWYFKNGASLYRKGGG 319 stiff brome
Q9S7Q5       257 FsCK-----QLNFlphPPPLFCLKNTKFDL-SSMPSENQTRVLFKTYSPWIYLHPKEDFLPSSVNWVFANGALLHKKGNE 330 thale cress
Q9SGI4       253 FsCQ-----PLNip-pPPPLFCLKNTKFDL-SSMPSHNQTTVLFQSYSPWIYLHPDEDFISSSVDWFFSNGALLFQKGNE 325 thale cress
KRH07720     226 F-VA-----QN-GstePPSIACLKNNTNAIpKYMPNLQQIKAIMQVYSPTMCLHPDEEYLPSSVDWFFSNGALLYKKGQE 298 soybean
KRH13778     218 F-FA-----HNGEipsPLPIACLKNTNMNFsSSMPNLPQVKALVQAYSPFMYLHPDEEFQPASTKWYFTNGALLVKKGEE 291 soybean
EEF38775     217 F-VA-----QNGNdnnPASLVCLKNVSNNL-SCMPNENQIQAIFQAYSPWIYFHPDEEYLPSSVSWYFNNGALLYKQGEE 289 castor bean
XP_015161606 218 F-MV-----QNng--aAESLACLKNVKSDI-SAMPNLNQVKALVQAYSPLIYFHPDEEYYPSSVTWFFQNGALLYTKGQE 288 potato
XP_004229552 209 F-MA-----SN-NgaaADSLACLKNVVEKF-TCMPNLNQIQALFQAYSPLYYFHPDEEYYPSSVTWFFQNGALLYAKGQE 280 tomato
XP_006364462 219 F-LARitSDKDDDsnkTLSLACLKNNKFDTfSSMPNLSQIQALFEQYSPIIYFHPKEKYLPSSVNWYFANGALLYQKGQE 297 potato
XP_002269745 256 F-VA-----QNGGaasSLSLACLKNISSNL-YAMPNLAQVDALVQAYSPWVYLHPDEQYLPSSVSWFFQNGALLYQQGEE 328 wine grape
KQK13488     320 cdaVGEEIDGEGSNLPGGGCNDGEYWIDLPQDTQRRAAVCRGDIGSAELYAHVKPAMGGACTDVAMWVFCPFNGPARLKL 399 stiff brome
Q9S7Q5       331 s--IPVPIHPNGSNLPQGGCNDDLFWLDYLVDKKAREKVKRGDLESTKVYLHIKPMFGATFTDIVVWLFFPYNGNAHLKF 408 thale cress
Q9SGI4       326 s--NPVPVQPDGSNLPQGGSDDGLFWLDYPADKNAKEWVKRGDLGHTKVYLHIKPMFGGTFTDIVVWIFYPFNGNARLKF 403 thale cress
KRH07720     299 s--NPVSIAPNGTNLPQDHNNDGAYWLDLPSDAANKERVKKGDLQSAKSYVHVKPMLGGTFTDIAMWVFYPFNGPSRAKV 376 soybean
KRH13778     292 s--KPVPIDPTGSNLPQGGNNDGEYWLDLPSDKANKERVKKGDFKSCQAYVHAKPMFGGTFTDLVMWVFYPFNGPGTAKV 369 soybean
EEF38775     290 s--NPVKVETNGSNLPQGGANDGVYWLDLPVDEKAKDRVKKGDLQETEVYLHIKPMFGATFTDIVIWVFCPFNGPAKAKI 367 castor bean
XP_015161606 289 s--SPVGIHPTGSNLPQDGSNDGAYWLDLPIDDAAKTNVKKGDLQGATAYLHVKPMFGATYTDIAVWLFYPFNGPAKAKL 366 potato
XP_004229552 281 s--TPVVVQPDGSNLPRDGSNDGAYWLDLPTDDSAKNRVKSGDFHAATSYLHVKPMFGATHTDIALWLFYPFNGPARAKI 358 tomato
XP_006364462 298 s--NPSSIEPNGSNLPQDGPNDGAYWLDLPIDEKDKEKAIKGDLLNSEVYLHIKPMLGATFTDIAVWIFYPFNGPGTAKL 375 potato
XP_002269745 329 s--KPVNIDPTGSNLPQGGSNDGAYWLDLPVDAKAKETVKKGDLQDSMTYMHIKPMLGATFTDIAIWIFYPFNGPARAKV 406 wine grape
KQK13488     400 GVL-NVPLGKTGQHVGDWEHFTLRVSNFTGELMAVYFSQHSGGRWVDASALEYAA-G-NRPVVYSSRNGHASYPYPAVYL 476 stiff brome
Q9S7Q5       409 LFIkSLSLGNIGEHVGDWEHVTLRISNFNGELWRVYFSEHSGGTLVDACDLEFMQgG-NKPVVYSSLHGHAMFSKPGVVL 487 thale cress
Q9SGI4       404 LFFkSLSLGDIGEHIGDWEHVTLRISNFNGELWRAYFSEHSGGTLVEACDLEF-QgG-NKLVSYSSLHGHAMFSKPGLVL 481 thale cress
KRH07720     377 EFI-NVKLGKIGEHVGDWEHVTLRVSNFNGELWQVYFSQHSKGAWVDSSQIEFQSgGgNKPLYYSSLHGHASYPHAGLNL 455 soybean
KRH13778     370 GLI-DIPLGKIGEHIGDWEHVTLRVSNFDGELKKVYLSQHSNGQWVEASQLEFQSg--NKSVCYSSLNGHAIYPKAGLVM 446 soybean
EEF38775     368 EFL-NVPLGKIGEHVGDWEHVTLRVSNFNSELWSVYFSEHSGGSWINASQLEFQSg--NKFVGYSSLHGHAMYSKPGLVL 444 castor bean
XP_015161606 367 EFM-TISLGKIGEHVGDWEHVTLRISNFNGELQGIYFSQHSGGIWVRASQLEFQNg--NKPVVYSSLHGHAAYPELGKNL 443 potato
XP_004229552 359 EFI-TIPLGKIGQHVGDWEHITLRISNFNGELQSVYFSQHSGGNWVSTPQLEFENg--NKPVAYSSLHGHACYSKTGQNM 435 tomato
XP_006364462 376 GLV-DVPFGKIGEHVGDWEHVTLRISNFNGVLYKVYVSQHSGGTWIDAPQVEFQNgS-NKVVVYSSLNGHAIYHKPGLVL 453 potato
XP_002269745 407 ELI-NISLGKIGEHVGDWEHVTLRVSNFNGKLMNVFFSEHSSGTWVNASELEFQNg--NKVVSYASLHGHAFYPKPGLVL 483 wine grape
KQK13488     477 QGSAalGIGIRNDAARSKLFVDSSVKYRIVAAEYLgDGVVAEPQWLQYMREWGPTVVYNSRKRMERIVGRLPRGLRDTAE 556 stiff brome
Q9S7Q5       488 QGGG--KSGIRNDMARSDKCFDAGIGYEVIAG-----PGVVEPPWLNYFRKWGPRVHYRIDIFLNSVAKILPIFLRKGLR 560 thale cress
Q9SGI4       482 QGDD--GNGIRNDMARSNKFFDAGVAYELVAG-----PGIQEPPWLNYFRKWGPLVPHDIQKNLEGIAKSLPGLLRKKFR 554 thale cress
KRH07720     456 QGTD--NIGIRNDTAKGDKMMDMGA-FELVSAEYL-GYAVIEPPWLNYFREWGPKIDYSIDVELKKIEKFLPKNLKDALE 531 soybean
KRH13778     447 QGLD--GIGIKNETKKSEKVIDMGVGFEVVSGEYL-GSAIVEPPWLNFLRQWGPKITYDIAKELDNLAKVFP-----ALE 518 soybean
EEF38775     445 QGNN--GIGIRNDTAKSGKILDTGAKFSVVAAEYL-GMTIIEPPWINFFRKWGPKISYNIADEIKKIEKILPGKLKSAFE 521 castor bean
XP_015161606 444 QGSG--DVGIRNDTGKGK-LMDIGANFLIVAAEYL-GSTIVEPVWLNYGREWGPKISYDISKELRKVERFMIGKLKKAIE 519 potato
XP_004229552 436 QGNG--NIGIRNDTAKGQ-VMDTGANYEVVAGDYL---EIVEPIWLNYAREWGPKISYDIANELKKIERFLPGKLKRAVE 509 tomato
XP_006364462 454 QGGG--DIGIRNDTTKSNLVLDCGKNYSIVAAENL---EIIAPAWLNYTREWGPKLSYTLGDEVKKIESSLKGNLKGAFE 528 potato
XP_002269745 484 QGSG--AMGIRNDTAKSKMVMDTGTRYIVVAAEYL-GSAVVEPPWLNYYRKWGPKISYDLAAEIKEVEKLLPGKLKSAFE 560 wine grape
KQK13488     557 NILNKMPNELSKEEGPTGPKEKNMWEGDE 585 stiff brome
Q9S7Q5       561 KLINKIPLEMRGQDGPTGPKVKVTWTGDE 589 thale cress
Q9SGI4       555 NLINKIPREVLEEDGPTGPKVKRSWTGDD 583 thale cress
KRH07720     532 KIMRSLPSEVLGEEGPTGPKVKNNWIGDE 560 soybean
KRH13778     519 ALEDGLPNELLGQEGPTGPKLKRNWQGDE 547 soybean
EEF38775     522 KVVNGLPSEVLGEEGPTGPKVKGNWTGDE 550 castor bean
XP_015161606 520 KIVRDLPNEVLGEEGPIGPKFKDMWSGDE 548 potato
XP_004229552 510 KLVKSLPNEVLGEEGPTGPKFKDMWNGDE 538 tomato
XP_006364462 529 KLVKVLPNEVYGEEGPTGPKMKGNWNGDE 557 potato
XP_002269745 561 KLVKSLPNEILGEEGPTGPKMKKNWDGDE 589 wine grape
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap