4IA5


Conserved Protein Domain Family
MCRA

?
pfam06100: MCRA 
Click on image for an interactive view with Cn3D
MCRA family
The MCRA (myosin-cross-reactive antigen) family of proteins were thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis. More recent work shows that these proteins act as hydratase enzymes that convert linoleic acid and oleic acid to their respective 10-hydroxy derivatives. It has been suggested that MCRA proteins catalyze the first step in conjugated linoleic acid production. Proteins in this family act in an FAD dependent manner. The structure of a fatty acid double-bond hydratase from Lactobacillus acidophilus has been recently solved showing four structural domains.
Statistics
?
PSSM-Id: 399238
Aligned: 126 rows
Threshold Bit Score: 530.118
Threshold Setting Gi: 1052818273
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4IA5_A        23 KSAYIIGSGLAGLSTAVFLVRDAQXKGENIHILEELPvaGGSLDGADRPNaGFVVRGGREXENHFECLWDXYRSIPSLEV 102 Lactobacillus a...
XP_002560829  15 TEAWIFGSGSEALASAVYLIKDAKVHPPKIHIIDKHLfsERISHRPGSWSdGYDQFAACLPVPAGLPMERLLATLPSTQS 94  Penicillium rub...
Q0CR61        15 PDAWILGSGTAVLASAVYLVQTTKIPPQNIHILNPHRslDAALHDRGDHYrGYDQFARCLPVPVGSPLKELLDSIPSGGR 94  Aspergillus ter...
GAD94831      18 idIWIIGGGVASLAAAVFLIKDANVLPTHIHMFDVHSalGGGLTGYGNPEkGYVLHPGQTISYHDSCVEKLLLQAPS-TH 96  Byssochlamys sp...
XP_002379842  27 VQAWLIGGGIASLAAAVHLINDAKVPGEHIHLLDEHKhaGGGMQSFGDAEnGYVLRTPCLPYFHDICVQDLLSYVPSPGD 106 Aspergillus fla...
EPS26543      10 VQAWLVGSGIASLAAAVHLINKAKVPPNQIHILDAHHasGGAMETSGDEKnGYILHTGAQPYFYEQCVKDLLAMVPSHES 89  Penicillium oxa...
Q0CDK0        12 TQAWLIGSGITSLAAALHLIKDARVPGQNIHILESNKnpGGGMTIHGGTEsGYFLPFECSPYFYGSCVERLLSLIPCGTD 91  Aspergillus ter...
Q4WF38        15 vQAWLVGSGMACLAAAVHLIREGNLPGKNVHILDLHLgfGGEMGTSGDAQnGYFVPFECHPYFHGDCIKDLLSIVPSPGE 94  Aspergillus fum...
CAK47235      15 TQAWLIGSGISSLAGAVHLIHDAGVPAANIHILDVHShaGGGIKSCGDAKsGYVLYTGSLPYFHDRCVEHLLSLVPSVDD 94  Aspergillus niger
Q0CEJ3        10 THAWLIGSGIASLSAAVHLIREAKVPPSNIHIVDVHPstGGGIRSCGNAEnGYMLYTGCLPYFHDRCVEDFLSLVPSKQD 89  Aspergillus ter...
4IA5_A       103 PGASYLDEYYWLD--KE--DPNSSNCRLIYNr--GD-RLPSDGQYGLG-KCANEIVKLIXTPEKEIEGQTIEEFFSDEFF 174 Lactobacillus a...
XP_002560829  95 QGPSLLEEIQTAEa-NRvpKKRDVRTCFLAMtkgSV-NHIPTDSLNLSiKHRIALIQILFKRETYLSQRQVQELLPENFF 172 Penicillium rub...
Q0CR61        95 QGSSVLHEIEAREg-LRdsGKTGGGTCFIIKrdgVT-EPASTQTWDLNfRSRVSLLRLMLINERRVGRAQIRDFLPESFF 172 Aspergillus ter...
GAD94831      97 PGATPWEKQIAQK--AEerRHARRLTRAIVPgqsGP-EKLDSQRLGLNlQDRLGLIRVMLENEHALGRKRVCDVFDGDFF 173 Byssochlamys sp...
XP_002379842 107 PNQSIMDAVRASE--SGegEKPTASSRLVEQrstGL-EKVDDRQFHLGiKHRWDLIKLMVEGEKAVADKAIKDLFDESFF 183 Aspergillus fla...
EPS26543      90 PDKNLWEVIREHG--NDnrPMNKAHTRAVSQsedGM-RKVDMHALPIGaKLRMDLIKFIVESERYLESKRISDVFDKSFF 166 Penicillium oxa...
Q0CDK0        92 PDRSVMDTVRARA--PGpeGKSVLSVRQVGAgpsGLpELVHREHLKTPiKHRMALIKLLLQREASIGEKTIRDSFEPDFF 169 Aspergillus ter...
Q4WF38        95 PGKSMMDDIYSLEknERrpPQDSGMTRAIKLgklGP-EVVHFRGIQVGlKHRLELMKFILESETSLGAKSINQIFEPSFF 173 Aspergillus fum...
CAK47235      95 PKQSLLDSIKELD--RAtsPKKSAPTRLIKHgdkGP-ECLYSKHLQIGpKYRMELIKLMLENERILGEKAIQDAFDEAFF 171 Aspergillus niger
Q0CEJ3        90 PKASLLESIKDYD--VLnrPQRSAITRLVKQghnGP-QRVDADDLQIGpRYRMELIKVMLESEKTLGAARIDEFFDEQFF 166 Aspergillus ter...
4IA5_A       175 KTNFWTYWSTXFAFEKWHSLAEXRRYAXRFIHHIDGLPDFTALKFNKYNQYESXVKPLLAYLKDHGVQFEYDCHVKNVEV 254 Lactobacillus a...
XP_002560829 173 QSPFWTIWSAQFGFQPWHSAAEFRRSIRQYMPQFHSLSILSCLDITGYYQYESLYSPIYRFLESCGVDFRFGVEVKDIQV 252 Penicillium rub...
Q0CR61       173 QSAFWAMWSAQFGVQPWHSAVEFRRALRQYLSESRTLNILSCLDISGYYQYEMIFLPLYFYLQSLGVDFQFDTKTEDIVL 252 Aspergillus ter...
GAD94831     174 STKFWMIWSTTFAFTPHHSAVELRRYLRKYLHDIGNSGKLSGPDEIRNSQHESIIQPISKYLREEGVDFRLNERVVDVLT 253 Byssochlamys sp...
XP_002379842 184 NSHFWTLWSTTFAMRPEHGAVEFQRHMRKYLEKIKDINNVSALDRTQYTLHDSVILPIIAYLEKEGVDFRFNAKVTDLVM 263 Aspergillus fla...
EPS26543     167 ESGFWNLWSTTFLLQEWHSAVEFHRLLSKWLPELHTHNDVREMERTPFTLFESLIAPITTYLKEQGVDFRFNIMVTDLKS 246 Penicillium oxa...
Q0CDK0       170 ETDMWSLWSTIFALQPWHSAVEFQRHLHKHLALVRHLTNIEHLSRTEFNLVESVVAPLISYLRQQGVDFRLGNRVTDLKA 249 Aspergillus ter...
Q4WF38       174 ETGFWTRWSTAFAFQPWHSAVEFRRHLRKYLEDIQALNDVKGAYRTKYNLFDSITLPLADFLKGEGVDFRFNVDVTDLLL 253 Aspergillus fum...
CAK47235     172 KTNFWTLWATTFALQPWHSLVEFRRCLCKHLAEIERLNDVKALDRTKYTIYESVIMPIESYLKSQGVDFHFNAKVTNLQI 251 Aspergillus niger
Q0CEJ3       167 KTNFWSLWSTTFALQSWHSILELRRCLRKHLGDIEDLNNVRALDRTKYTIYESIIMPVTEYLKDQGVDFHFSSRVSRLEM 246 Aspergillus ter...
4IA5_A       255 dhegdskIAKKIVXTQ-NG-KDKEIDLTHNDIVFVTNGSITESSTYGDQNTPA---PITN-Ak----GD-SWKLWENLA- 322 Lactobacillus a...
XP_002560829 253 skddakpKVTGFNLVKgKQqLR--KQLGENDIVIMNIGSTISGSAVGTNNSSP---VWQSlDaddlfDQ-NWSVWLDLG- 325 Penicillium rub...
Q0CR61       253 sges-rrqVSQLHLLRnGVrEN--QFLGPADIVLVNLGSTVSGSTSGNSNYPP---PRSSmEadeelDE-NWSIWLNLR- 324 Aspergillus ter...
GAD94831     254 ypdgdptTVSEIKFLGpDGsEK-MVTLDPSDLVFVTLGSVGSGTVMGDNVSAPgqpSMKAsAn-------EWALWDKLA- 324 Byssochlamys sp...
XP_002379842 264 ypegdptTISEIKLVHdDNsPS-LVIIDPMDIVIVTLGSVSSGSAVGSNNAPPkweAWD--AledtiME-DWSLWNKVSg 339 Aspergillus fla...
EPS26543     247 ypssdptTISELVLLEnG--HELLITIDPVDILIITLGSVATGMQTGSNKEPP---PPLSsPfmdimNSgEWSLWQKLE- 320 Penicillium oxa...
Q0CDK0       250 ypepdptTISEIEIIGpDGhQE-LITLDPVDIVIVTLGSTGSGAAYGTNTSPP---SGLTaDwedlmEG-DWKIWEKLA- 323 Aspergillus ter...
Q4WF38       254 ypesdptTVSEIKLIKeG--DECLITLDPEDICIVDPGYSRSGADFGTDTAPP---PFLTsNwedlmMK-EWKLWQKLS- 326 Aspergillus fum...
CAK47235     252 npkeaqtTVSGIIIKDnG--EQKTIEVRPEDLVMVTLGSTTSATERGSNDKAP---AAPPqHskeflDD-DWALWIDLM- 324 Aspergillus niger
Q0CEJ3       247 dpdsqqtTVAKIVIQEeT--EDKEVEVDPSDIVMVTLGSPNSGSQVGSNLEAP---AHFPeKsdeliDH-DWALWIDLM- 319 Aspergillus ter...
4IA5_A       323 -KQDPAFGHPDVFCENLPERSWfVSATATLENKKLAPYFERLTKRSLydgkvnTGGIITIVDSNWELSFTIHRQPHFKSQ 401 Lactobacillus a...
XP_002560829 326 -NKHNGLGNPYNFCTRQSETMV-ESFTITTQDLVLYDDLRSLIKCRSe-----AGAFIFLGDSNWKINLCIPAQPVFSSQ 398 Penicillium rub...
Q0CR61       325 -SKSDHFGEPYSFCTRQFESIM-ESFTVTVKDPLVFQQLASLAKNSAe-----AGTFIVILSSQWKLHICVPHQPVFPDQ 397 Aspergillus ter...
GAD94831     325 -GRSIKFGNPSNFCNTPANSTL-GTFTVTLYDSEFFDRIQEITGLAPg-----SQPVLSLPKSNWEISLNTPHQPVYHTQ 397 Byssochlamys sp...
XP_002379842 340 mATR-KFGNPVPFRSHIKESKV-VTFTITLKDSTFLEDYQRMTHNEPg-----SAALVSFVKSNWNLSLSVPSQPLFANQ 412 Aspergillus fla...
EPS26543     321 -KQSTKFGNPANFSNRLSESQI-ETFTVTLHDADFMHHYAHLTRDKPg-----TGALLTIQDSPWGLTISVPHQPVFATQ 393 Penicillium oxa...
Q0CDK0       324 -QMAPKFGNPTNFLPRIQESML-ETFTTTISGPAFSSMYADLSGDSAd-----NGALLLLRDSNWRMTVIKPHQPIFRDQ 396 Aspergillus ter...
Q4WF38       327 -DKSPKFGNPSNFLSRALESGV-ETFTTTLWGPQFMNLYEKLTHDQPr-----TDALLSLTESKWSITLSIPHQPILPGQ 399 Aspergillus fum...
CAK47235     325 -QASTDYGNPFNFHNNVDQSTL-ESFTVTLRDSDFMERYEKLTNNKPg-----TGALLSFSDSNWGLSISVPRQPVCSDQ 397 Aspergillus niger
Q0CEJ3       320 -HKSPSFGDPKHFTQNPHHTAV-ESFTITLKNSDFLKQYEKATGDSAg-----TGALLSFTDSNWGLSISVPHQPLCANQ 392 Aspergillus ter...
4IA5_A       402 NPDQIVVWIYALYSDTEGNYIKKRIVDCTGKEIAEELLYHLGVPESqiSELAsEENxNTVPVYXPYITSYFXPRRDGDRP 481 Lactobacillus a...
XP_002560829 399 PEDVRVLWGFAHAPRVEGNYVNRILLHCSGADILSEILGHLNLH-Y--NPPL-SRT-VTIPRAMPRMSSLFITRALNDRP 473 Penicillium rub...
Q0CR61       398 PRDVCVLWGFSNSPLCKGDFIKKPMVQCSGNEILTEALRHLNLD-V--ELFL-QHT-ITIPRLMPRMSAALLSRVQGDRP 472 Aspergillus ter...
GAD94831     398 PDTVKVFAGWALHPEKNGNYVKKTMMECTGAEVLQEILRQLDFP----ETLL-SQA-VTIPCISPLATSALLPRSHNERP 471 Byssochlamys sp...
XP_002379842 413 PANVHVVWGYGNDPEKPGNFVHKPMQDCSGKEILLEVLGHLGID-Q--ERIL-PSA-NTIPYIFPLATASLLKRSHFDRP 487 Aspergillus fla...
EPS26543     394 PKSVHVIWGYGLQPERVGKYIKKPMLRCSGEEILRELLSHLGFP-C--DSLI-SSS-ITIPCLIPLGTSMLLSRGLHDRP 468 Penicillium oxa...
Q0CDK0       397 PEDVTVLQGFALNPTAEGNYIKKPMCDCTGEEVFQEVLSHLCRD-A--GSVA-ASA-KTVPCGMPLGTSPYLTRSHGDRP 471 Aspergillus ter...
Q4WF38       400 PPDAHIVCGYALSPWNEGDFVKKPMFACSGKEIFTEVLSHLGFP-V--QSIL-DAA-TTIPCGLSLGTAPFLTRGNRDRP 474 Aspergillus fum...
CAK47235     398 PSSVDVFWGYGLHPEKTGNFVHKPMCHCSGKEILTEVLSQLGMPV---DDML-ANS-ITNPVLMPMATAPLMPRRHDYRP 472 Aspergillus niger
Q0CEJ3       393 PLDVVVIWGYGLHPDETGNFVSKPMCRCSGREIATEVFSHLGFS-L--DDLL-PRS-NTIPCLMPLGTAPLLPRGPDHRP 467 Aspergillus ter...
4IA5_A       482 DVVPEGSINLAFIGNFAESpTRDTVFTTEYSVRTAXEAVY 521 Lactobacillus acidophilus NCFM
XP_002560829 474 SITP--LSNVGLVGPFTES-SGYTCSDVSYGIRTAKTAVY 510 Penicillium rubens Wisconsin 54-1255
Q0CR61       473 QVIPEGTTNIGFIGPFVEN-SHYSTVDISYEVRTAQKAVs 511 Aspergillus terreus NIH2624
GAD94831     472 EVIPHDTTNLALLGQFVEI-ADEPSLTMEYSVQSAQLAVd 510 Byssochlamys spectabilis No. 5
XP_002379842 488 EVVPHNATNMAFVGQFVEI-PHDTTFSMEYSVRSAQMAVY 526 Aspergillus flavus NRRL3357
EPS26543     469 NVIPHGTTNLGLIGQYVEI-PADAACSLEYSVRGAQLAVa 507 Penicillium oxalicum 114-2
Q0CDK0       472 AVIPENTTNIACVGQFVEI-AGDTSLEVEYSVRGAQLAVa 510 Aspergillus terreus NIH2624
Q4WF38       475 HVIPPYTTNIACVGQFAEL-PEDTTLSMEYSVRSAQMAVY 513 Aspergillus fumigatus
CAK47235     473 EVIPPQSRNLALVGQYVEI-QDDTTLSMEYSVRGAQMAVF 511 Aspergillus niger
Q0CEJ3       468 RVIPPQTKNLAVLGQYVEI-AEDTTLNMEYSVRSAQMAVY 506 Aspergillus terreus NIH2624
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap