Conserved Protein Domain Family
Radial_spoke_3

?
pfam06098: Radial_spoke_3 
Radial spoke protein 3
This family consists of several radial spoke protein 3 (RSP3) sequences. Eukaryotic cilia and flagella present in diverse types of cells perform motile, sensory, and developmental functions in organisms from protists to humans. They are centred by precisely organized, microtubule-based structures, the axonemes. The axoneme consists of two central singlet microtubules, called the central pair, and nine outer doublet microtubules. These structures are well-conserved during evolution. The outer doublet microtubules, each composed of A and B sub-fibers, are connected to each other by nexin links, while the central pair is held at the centre of the axoneme by radial spokes. The radial spokes are T-shaped structures extending from the A-tubule of each outer doublet microtubule to the centre of the axoneme. Radial spoke protein 3 (RSP3), is present at the proximal end of the spoke stalk and helps in anchoring the radial spoke to the outer doublet. It is thought that radial spokes regulate the activity of inner arm dynein through protein phosphorylation and dephosphorylation.
Statistics
?
PSSM-Id: 399236
Aligned: 45 rows
Threshold Bit Score: 235.608
Threshold Setting Gi: 121890434
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CBZ08799                       49 YGNIMYDRRVYRGNTYASPIMSI-------------AARAEME--KREMIdtQRRKQA----SQRAASIKRRKqleaa-- 107  Leishmania infantum JPCM5...
XP_003248341                  176 YTNIMHDKRVVRGSNFAKKSFRPkwnpyfgyakqlsSEMGKESpaAREAE--ARRRAM----ARKKAIDYQTRamr---- 245  pea aphid...
XP_001705189                   25 PVNSMSDPRVAKGSTWAREAGGS-----------------------------NYGRSLgltnTRTRALQNAARtgvsdlm 75   Giardia lamblia ATCC 50803...
XP_001323328                   30 pCLITVDPRVCRGSTYSRHK--------------------------------PVEQEApkpkPKRKLASPRDRslmagip 77   Trichomonas vaginalis G3...
EAX95809                       29 FWHISVDPRVARGSVYSHHKPQT----------------------DQVKPikYKPKPIpppkEREEDVHPEEEev----- 81   Trichomonas vaginalis G3...
CBJ30359                       50 pINIHHDPRVARGNTFA----------------------GDRRdaQPSAE--PGPKTVak-kSRKRLGQSRSRgssssff 104  Ectocarpus siliculosus...
A0DT20                         45 gsNIMFDKRVVRGNTYASVQTQG----------------------DKKLMtlKSFKKP----QQKAAQQPQTTyl----- 93   Paramecium tetraurelia...
A0EG05                         22 PCNIMWDKRVIRGNTYSSVLNKS----------------------EPTMQttIKRIQNtkvvTEK--------------- 64   Paramecium tetraurelia...
WGS:AAGF:cds.TTHERM_00566810A  37 VQNLMFEKRVVRGNTYARIITSK----------------------DNEIKnaTKSGKS----FKKTIQIQKEQidyqr-d 89   Tetrahymena thermophila SB210...
XP_001007288                  199 FALLMQDKKVKMMNPV------------------------------------QQEQEYvrleKERIKIENMNAqlinfkk 242  Tetrahymena thermophila SB210...
CBZ08799                      108 rrhmATP--DPGEGRYNTQIQTDEYLEELTDKVD--QQVQETQTDPLMDRPVTPKYVPIKSGRDAETQIH-EGDLFRFDE 182  Leishmania infantum JPCM5...
XP_003248341                  246 -lhlGAP--KLPRGRQNVDIQTDVHLEELYDYPV--SQTFGAQTEFDQEMFSNPG-TGTSAGTDASTQVD-DKDLFDFDT 318  pea aphid...
XP_001705189                   76 smvpERP------SLPSIPVQTAPYLEAYPDKIE--EAGACTQTDPMLEIKEPAPYVPPPQGIDVSTQIE-EGDLFDFDR 146  Giardia lamblia ATCC 50803...
XP_001323328                   78 ndtlVAA--PQKENRIDLEIQTEPYLQEVVEKPV--IVNQDTQTDEFLDRPETPPYIPPKNGIDIEIQVV-ESDLFDFDF 152  Trichomonas vaginalis G3...
EAX95809                       82 -----------------sQINQEPILSEI-ERPI--EDDVATAAETYIERPATPQEVKDEPGIDVETQTN-AAELFDFDT 140  Trichomonas vaginalis G3...
CBJ30359                      105 dtraSQP-----VLREELDLS--RYLVEPGDTAArpEREADTQTDDFQERPQTPDFVPKKTGVDAWTQIEvSDKLFDFEA 177  Ectocarpus siliculosus...
A0DT20                         94 --hpSTP--RPFQNRVNIDIQTDEYLEILTDKPP--EQEMDAQTDYYIDKPPDRLFVPKKNGIDKETQIW-EGDLFDFDQ 166  Paramecium tetraurelia...
A0EG05                         65 ---------KEDETIHNEETQTDPNVEELTDKPP--RHLKETQTEFIIEKVVPRLYMKEKTGIDEETQVWdDGELFNFEY 133  Paramecium tetraurelia...
WGS:AAGF:cds.TTHERM_00566810A  90 qyepGTP--KPVAGRQNIEVQTDEFVEQLTDKPP--EYEKDTQTEVFIDRPNPRLFMPKKTGIDQETQIW-DGDLFDFDY 164  Tetrahymena thermophila SB210...
XP_001007288                  243 nkkrMAPydIKPSPNPRIDVNLEFFLTDNINTIPpiQAEIDCQTDDFIPKPPSPKYVPKKTGIDAYTQVE-DYELFDFDR 321  Tetrahymena thermophila SB210...
CBZ08799                      183 AVEPILEVLVGKTLEQAMLEVMQEEELELLRQQQIEFEQRRKEELLETQKLEAEERRKFEEKERRKKQEMERIQREKETR 262  Leishmania infantum JPCM5...
XP_003248341                  319 EVTPIAEALISDAFRTAMQEVLYEDELETRARQQRALCMKRKVEEIEMKRLQYQDERL----KQVIAEHSTMFDEGDERE 394  pea aphid...
XP_001705189                  147 EVQPILDVLVGSVLQQALREFSDEEELRLIRIARDKVRQRRAAELQEVRRLEEAERRRRAEIVKRQVEDLRRKELEEAVA 226  Giardia lamblia ATCC 50803...
XP_001323328                  153 EVKPIVATIVSKTLEQAFLEVHEEEELIAIRRHKEAIEHNRNVELADVQRLEEAEKRKFEEKQHRLEEREKIEREQKELR 232  Trichomonas vaginalis G3...
EAX95809                      141 EVKPRTIILVQNILDRALREVQEEEELKNLRQHRDNYEVGRNITLANLQKREAATKRTHDESKRREEQRERHYQEKNEKN 220  Trichomonas vaginalis G3...
CBJ30359                      178 EVQPMLAVLVGKTLEQARMEVEREHELLCIREAATALVHQRAEEVQQVLELKQAAVEAEKKKEELRRRQREEANRRRLAK 257  Ectocarpus siliculosus...
A0DT20                        167 EVEPILQVLMNKILEQSRMEVLEEEEIKLMKHQQKQHEKQKTSVLSEMQRLEAVQQRLDQEEARRKLQYETFLKIQKQSH 246  Paramecium tetraurelia...
A0EG05                        134 EAEPILQVLVRKTLDLSRMEVLQEEELREMKEKQEHYQKLKQMEMAEQDRLEKKEQQLYNENIKLKQQFHNQKQRDIKTH 213  Paramecium tetraurelia...
WGS:AAGF:cds.TTHERM_00566810A 165 EVEPILQVLLGKTLEQSRMEVLEEEELRVMKEQQKRFEQLRNAELAEMQRLEAKEKRLYEESERRKLQYKKQKEQNVLSH 244  Tetrahymena thermophila SB210...
XP_001007288                  322 EVTPIVDVIVTKTLEQSMLEIEQDEEILNMRKFKRQYDHRRDAEKKKTFQIYEREVNTMKEKDRLLDLYRQKENQKIDCL 401  Tetrahymena thermophila SB210...
CBZ08799                      263 EKLQARQFAKVYMSNMENRVFSRLQDEGWFADRVLNEVELDFFPWLMTEVDRELAKKTKARALVDELIRDVVRLNASQ 340  Leishmania infantum JPCM5...
XP_003248341                  395 KQRISSELTSGRVTDLLPKVLDDLSEKGLTTTTANKLESPEFVAWLTEELQADKTKHTESDEILKSMIHDLVSRRLDS 472  pea aphid...
XP_001705189                  227 RKMAAQTFATAYAAELEKDAVDSIETRGGFISPLEAAVTGSFVPYIVSTSITKAKARGRIHSILRCIIEEAVRTglsm 304  Giardia lamblia ATCC 50803...
XP_001323328                  233 EKIAARGYAEFFASDLISSAITTLERRGFFYDEVERDIETNFMPWLAKAMLESGETRDLQEAIVDQVNNETIRVEEKM 310  Trichomonas vaginalis G3...
EAX95809                      221 KDISTRGFAESYAEEIVKKVFDSLT----YYDEVEEEVRTQFLPWLSSEVALAITQK--------DFLLELQESAQSK 286  Trichomonas vaginalis G3...
CBJ30359                      258 EKVACLQLVRQVLPLSLDRAFEQLSAKSWETQSVQ-QIKKVFLPWLFGRVAADVGQRSSVLDALDSLLESVDETAETA 334  Ectocarpus siliculosus...
A0DT20                        247 QKIVCRNLSKSLINPLKQNTIKKLQDLGVFRDPLETALLYEYIPWVYENVLSQLVDENDNASNFNNILNNMEETITIE 324  Paramecium tetraurelia...
A0EG05                        214 EKLVSRASAKKYLSKCVNLALQQLELSGYFRDPVEIQLISEYLPWIYQDVTTELLSSNHIFVEYNSMLDNIDDDMFKL 291  Paramecium tetraurelia...
WGS:AAGF:cds.TTHERM_00566810A 245 KKLISRNIAKQYLSKLRGNVVNMLEDQGVFRNPLQMSLYDQFLPWLYQNVQQELIQQHNIETELENLCVELIEENKAL 322  Tetrahymena thermophila SB210...
XP_001007288                  402 HRVQNYSIARNYLRDVKVNAISKLYNAGYYPNDLKISIETDFIDWLVEETSKEIQERKALKDSITNTFDQITLHQLRe 479  Tetrahymena thermophila SB210...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap