Conserved Protein Domain Family
Asparaginase_II

?
pfam06089: Asparaginase_II 
L-asparaginase II
This family consists of several bacterial L-asparaginase II proteins. L-asparaginase (EC:3.5.1.1) catalyzes the hydrolysis of L-asparagine to L-aspartate and ammonium. Rhizobium etli possesses two asparaginases: asparaginase I, which is thermostable and constitutive, and asparaginase II, which is thermolabile, induced by asparagine and repressed by the carbon source.
Statistics
?
PSSM-Id: 399230
Aligned: 201 rows
Threshold Bit Score: 312.103
Threshold Setting Gi: 158113616
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EGY23680         11 TTRGTVQENRHRVHAAIVDAGNNLLLAVGDPERVTLVRSTIKPAQALAILETGALsPATdpAFTAADLALVCASHSSEDR 90  Verticillium...
WP_013181822     11 VTRGDIVESKHYGHIAVVNSKGKLLYSLGNPSSLTFFRSALKPFQASTVIATGAL-EAY--KMSTKELAFVSSSHTSEPK 87  Waddlia chon...
jgi:GYMC10_5544   8 EYRADILECVHNGHICIVNEQGKVEAYAGDPDYVAFTRSSAKPMQAIPSIRGGLA-DHY--GLSDEEIAIMTASHRAEQA 84  Paenibacillu...
WP_025336511      8 EYRANLMECAHSGHIAMVGENGVLKGYSGDPGFVSFTRSSAKPLQAIPGIRGGIA-GKY--GLSAAEVALMTASHRGEDY 84  Paenibacillus
jgi:GYMC10_3938   9 EYRGNVLENVHYGAISVVDENGKVVYAAGDPHHMTFLRSAAKPFQAIPVMKRRID-EVY--GLTGEETALFAASHRGERF 85  Paenibacillu...
BAH45559         15 EYRGGILENVHNGIVCGVNEKGEVAYRAGDVNHITLLRSAAKPFQAIPIAKRKID-EKF--GLNNGEAALFAASHRGEVY 91  Brevibacillu...
Q73R93            7 SYRGKIEDLYTFGSIAVVDKNGKIVYSAGDPKEVSFPRSSAKLIQALVPLSLGAK-EKF--NLSHEEIAQICASHSGEDF 83  Treponema de...
WP_010075034      7 LTRSNRIESIHAGYICITDSNNNVLYNIGDCKDKVFLRSAAKPFIATTFIKSGAM-EQF--DISEKELAIICSSHTGEDY 83  Clostridium ...
WP_010075033      7 LTRSGYVESIHYGYICVVDSSGKIIKEIGDSNTKIYFRSSAKPIQAVPVIESGAS-QHF--GFTKKEISIMCSSHSGQIM 83  Clostridium ...
CCY61221          8 EYRGDVVENVHYGSIAIVSSTGETIAYTGDIERQTYMRSASKPIQVLPTLLAGLH-KKY--NLSEEEVTICNSSHWGSNH 84  Clostridium ...
EGY23680         91 HVARATALLARVpgGATEADLRCGGHDAVSPAVNRRWIRHGFVPGP------LCNNCSGKHAAMLAGAAALGAGFADYHL 164 Verticillium...
WP_013181822     88 HIECLEQLLQRV--KIPANSLYCGRSKHSQEGSS-------KIPDK------TYHECSGKHIGLIAAAKQIGEDHNQVSY 152 Waddlia chon...
jgi:GYMC10_5544  85 HVEVLERFARKA--GISETHMVCASSWPLDEGSKETLLRGGGDKSK------WYHNCSGKHYGMLAYCQMAGYPLTGYDQ 156 Paenibacillu...
WP_025336511     85 HLQALESISAKT--GITESCMICASSYPLDEGSREEAIRSVGKR-K------LYHNCSGKHLGLLSYSKSKALPLESYAQ 155 Paenibacillus
jgi:GYMC10_3938  86 HIDALESILKKT--GIREEALHCCATYPLNEDAKAQRHRDHEEKRR------IFHNCSGKHSGLIALCKHMGWDESTYYK 157 Paenibacillu...
BAH45559         92 HIERLESILQKT--GIQENELLTCPTYPLNEEPKFACLSQGKEKRR------LFHNCAGKHLGYLALSKDQGYSTHDYYK 163 Brevibacillu...
Q73R93           84 HIKTVTGILKKI--GLDESALKCGPHYPFKPEVELRMKVNNEKPRD------IHNNCSGKHSGMLAAAVLMKASTDDYYK 155 Treponema de...
WP_010075034     84 HRETISSILNKI--GVSEEDLKCGISAPYNKEMNERLIRKNERPSK------LYNCCSGKHSGMLAACKALGLPIDSYND 155 Clostridium ...
WP_010075033     84 HQDTVTEMLKKI--GEEANVLKCGIMIPYNKEEANRLQSSKEKPSV------LHCSCSAKHVGMLTLAKYKNYSIDDYNR 155 Clostridium ...
CCY61221         85 HIYVLQSIMEKT--GLKEEDMIMNPTISTSATPLADKLALGSKLNPvegksrLQHCCSGKHLSLMLLQRELTGKVTGYQL 162 Clostridium ...
EGY23680        165 PAHPMQARVRSVVEDLCGLSGDQVLWAVDGCNLPAPAVPLRNLAMTFARFAAaadevaqtpvGAATTapsaRTEKMARIY 244 Verticillium...
WP_013181822    153 LHHPVQEMVMEQISHYCDYTP--TSIGIDGCGLPTVAIPLEQIALGYARMGEe---------FGKSN--------LGQVA 213 Waddlia chon...
jgi:GYMC10_5544 157 PEHPLQQEILRTVAYLAGLAPGDVKLGTDGCGLPVFAMPLRALATAYMKLAC----------PDLIEde-pTRKAVMQIT 225 Paenibacillu...
WP_025336511    156 PDHPVQQEVLRTVAYMAGLSPKDISLGTDGCGLPVFALPLTALAHAYLKLSC----------PELIEdi-aTREAVKQIT 224 Paenibacillus
jgi:GYMC10_3938 158 PGHPAQQEILETLAYFAEVPVSSIPQGIDGCGLPIFALPLDRIGYSFLKLAC----------PDLIEdp-eTAEAAARMA 226 Paenibacillu...
BAH45559        164 AEHPAQQEALEVFASLADYPKAQVQLSVDGCGFPVFALPLKNLAIAYLKLAC----------PDLIEdq-kTREAVERVT 232 Brevibacillu...
Q73R93          156 PQHPVQQKIREMIELICDCKIPDDNISVDGCGVPVHSLPLYNFAFGMARMADy---------KNLPQn---LSTHAKDII 223 Treponema de...
WP_010075034    156 KCHPLQKLILYNISKLLGCSEEDIILGIDGCTVPSFMITIQQISYLYALLADg---------GNTKEe---YKDALTKIR 223 Clostridium ...
WP_010075033    156 IDHPAQHEILNTISYFTDYNEENITVGIDGCGAPIYIIPIYNIALSYARIMNf---------ANDENs--kYHKACKTII 224 Clostridium ...
CCY61221        163 PDSPVQKQIISFLSMLSQTPTYRISLGIDGCGVPVFALPMRNIALAYAKLADp---------FNLPDd---IREAITYNF 230 Clostridium ...
EGY23680        245 HAMAQHPEMVAGEGRFCTILMELFGGALIGKLGADGCYAIGiresehTRrlgaKGALGLAVKIEDG--SIEILYTAVVEI 322 Verticillium...
WP_013181822    214 KAMSKHPWYVGGSQRFDTEIMRAFRGEVIAKRGAEGILCIS------IP----SKKMGISIKCEDG--SHRPIPMAALSL 281 Waddlia chon...
jgi:GYMC10_5544 226 KAMHAAPYMVAGKHKVDTLLLEDPN--IVAKGGFKGVYCFG------LK----KERLGISFKISDG--SEEEWGWIAESI 291 Paenibacillu...
WP_025336511    225 SSMHAHPEMVAGYGRLDSLLLEDDN--IVAKGGFKGVYCFG------LR----SERLGFAFKILDG--SEEEWGLIVRSI 290 Paenibacillus
jgi:GYMC10_3938 227 KLMNEYPDIIADTKFVCSALLRDHN--LTAKGGAKGVYGIG------LR----KERLAISLKVSDG--SEQVWPCIIASI 292 Paenibacillu...
BAH45559        233 GWMTSSPEIIASHNFICTALLMDEN--IIAKGGAMGVYGFA------LK----KERLSFSLKVLNG--SELVWPLIIASI 298 Brevibacillu...
Q73R93          224 DSITACSEYTSGTDRIDHLLVKKYPEKLVVKSGANGYFGGL------LP----DKKYGIAVKTYDG--ISKTRDIVLVHL 291 Treponema de...
WP_010075034    224 NSMVAYPEMIDGYEEFYTELMGHSDKRMIAKVGDEGLYCVA------VP----EKKIGIVVKIVDG--NERACYPVIIEV 291 Clostridium ...
WP_010075033    225 ESMIEYPEMVAGDEEFCTELMRFTNGKLIGKVGSEAVYCVG------IK----DKGIGICVKIIDG--NERAVYPVVMQI 292 Clostridium ...
CCY61221        231 DCINKNPEKIN--DYFTPSYYVNKNPDLLMKDGSRGVICMA------IR----SRKLGIVIKLEDGwsD-EYQGIIVARI 297 Clostridium ...
EGY23680        323 LLQLGIEMPPG--REELLKFHQLKRKNTWGVETGIVTP 358 Verticillium dahliae VdLs.17
WP_013181822    282 FEKLNLLTKHGlhTLKQAHPHWHKILNSRNESVGSIHs 319 Waddlia chondrophila
jgi:GYMC10_5544 292 LEQIGYGSKAT--IERLKAAYPKDLYNDEGLRVGRVEt 327 Paenibacillus sp. Y412MC10
WP_025336511    291 LEQIGYSNRAT--ISKLEAAFPNEIVNDEGMHVGRAEt 326 Paenibacillus
jgi:GYMC10_3938 293 LERLGYSDQST--IDRLYELVPNAIFNDGGTLVGERRa 328 Paenibacillus sp. Y412MC10
BAH45559        299 LEQIQYDNPET--IDRLHALAPKAIKNDNQLVVGEKRs 334 Brevibacillus brevis NBRC 100599
Q73R93          292 LKKLGVIDKAD--YEYFDNLADKNIKNHRGETAGEVVP 327 Treponema denticola
WP_010075034    292 LKQLGIFTKTE--SKQLYNWAFTPLKNH----VSDVIG 323 Clostridium cellulovorans
WP_010075033    293 LKELNILDKNE--LNNLQHWSRVELKNNLDEVIGDILp 328 Clostridium cellulovorans
CCY61221        298 LEQLQYDDKEL--IEQLKETYNTKIYNDCKDEVGHAEA 333 Clostridium sp. CAG:264
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap