Conserved Protein Domain Family
Cytomega_TRL10

?
pfam06084: Cytomega_TRL10 
Cytomegalovirus TRL10 protein
This family consists of several Cytomegalovirus TRL10 proteins. TRL10 represents a structural component of the virus particle and like the other HCMV envelope glycoproteins, is present in a disulfide-linked complex.
Statistics
?
PSSM-Id: 399227
Aligned: 5 rows
Threshold Bit Score: 244.149
Threshold Setting Gi: 81953785
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ACL51079  22 VCAETKVATNCLVKSENTHLTCKCSPNn------TSSnTGNGSKCHAMCKC-RITEP---ITMLGAYSAWGAGSFVATLI 91  Human cytomegalovirus
Q914P5    22 VSTETTVATNCLVKTENTHLTCKCSPN-------DTS-TNGSNKCHARCKC-RVTEP---ITMLGAYSAWGAGSFVATLI 89  Human cytomegalovirus
Q910I3    22 FCAETTVATNCLVKTENTHLTCKCSPN-------NTSnTGNGSKCHAVCKC-RVTEP---ITMLGAYSAWGAGSFVATLI 90  Human cytomegalovirus
Q910I9    22 VCAENTVTTNCLVKTENTHLTCKCNPN-------STSt--NGSKCHAMCKC-RVTEP---ITMLGAYSAWGAGSFVATLI 88  Human cytomegalovirus
Q8QS87    18 TAIHNDV---CTSLDGQTRLLCKCNRWnnnsnpkPTAtSGTHITCLANCTCkRYTEPlplISVLGIYSAWGAGSFIATLI 94  Chimpanzee cytomega...
ACL51079  92 VLLVVFFVIYAREEEKNN-TGTEVDQCLAYRSLTRKKLEQHAAKKQNIYERIPYRPSRQ-KDNSPLIEPTGTDDEEDEDD 169 Human cytomegalovirus
Q914P5    90 VLLVVFFVIYAREEEKNN-TGTEVDQCLAYRSLTRKKLEQHAAKKQNIYERIPYRPSRQ-KDNSPLIEPTGTDDEEDEDD 167 Human cytomegalovirus
Q910I3    91 VLLVVFFVIYAREEEKNN-TGTEVDQCLAYRSLTRKKLEQHAAKKQNIYERIPYRPSRQ-KDNSPLIEPTGTDDEEDEDD 168 Human cytomegalovirus
Q910I9    89 VLLVVFFVIYAREEEKNN-TGTEVDQCLAYRSLTRKKLEQHAAKKQNIYERIPYRPSRQ-NDNSPLIEPTGTDDEEDEDD 166 Human cytomegalovirus
Q8QS87    95 ILLVIFFVIYSRERPADDdNGTVEDPFLAYRDLTRKKLDSHASKKQNIYERIPYRPCRQlRDDEPPLITNAEDDDEEEDN 174 Chimpanzee cytomega...
ACL51079 170 NV 171 Human cytomegalovirus
Q914P5   168 NV 169 Human cytomegalovirus
Q910I3   169 DV 170 Human cytomegalovirus
Q910I9   167 DV 168 Human cytomegalovirus
Q8QS87   175 F- 175 Chimpanzee cytomegalovirus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap