Conserved Protein Domain Family
Orthopox_F14

?
pfam06076: Orthopox_F14 
Orthopoxvirus F14 protein
This family consists of several short Orthopoxvirus F14 proteins. The function of this protein is unknown.
Statistics
?
PSSM-Id: 114778
View PSSM: pfam06076
Aligned: 2 rows
Threshold Bit Score: 95.5417
Threshold Setting Gi: 56404726
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P68707  1 MKHRLYSEGLSISNDLNSIIGQQSTMDTDIEIDEDDIMELLNILTELGCDVDFDENFSDIADDILESLIEQDV 73  Vaccinia virus WR
P33872  1 MKHKVYSEGLEISTDFNSIISQLSTSDMDIEIDEDNITELLNILTELGCDVDFDEDFSDITDDVLESLMEQDM 73  Variola virus human/India/Ind...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap