Conserved Protein Domain Family
DUF930

?
pfam06059: DUF930 
Domain of Unknown Function (DUF930)
Family of bacterial proteins with undetermined function. All bacteria in this family are from the Rhizobiales order.
Statistics
?
PSSM-Id: 399213
Aligned: 25 rows
Threshold Bit Score: 125.473
Threshold Setting Gi: 501835939
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2KAV4                29 LEKLDPSTRLEQSCDTEAMSRINNDSTGFKPDKVIAYTFKDPIAGDNSLQAPGAVFRSKGDWYHLSYNCITGPQHINVRQ 108 Rhizobi...
Q7CXQ3               260 fGDLPPRRRIVQLCQTEALAQIREVYPATRG--MYGFSDTGGRISGNVLDATGGAFNVGDVWHDVTFQCDVDVDNYAVTA 337 Agrobac...
vbi:Avi_3101         264 LGTLPPERRIVQICSIEMLEQVRRAVPGAVPDVIAGSPTTRQTVTARLMDVSGAAFRSRGQWYDIGYHCETDAKTQAITS 343 Agrobac...
jgi:Oant_4161        196 LGKLAPKDRIIQICGIEALEQVRRHKAGAFPDML---AREGGSVSTTGLTVSDGAFRSQRKWYAIDFTCKVDAETMVIGS 272 Ochroba...
goetting:NGR_b20370  211 iGRLPPKRRIVQLCTIEALEQVRRARPDAFPDMLVPFGPVGGMVSASGLSANGGAYRSRGKWYGIDFKCEVNSETTSVAS 290 Sinorhi...
Q2K621               275 IKNLPRSARINVLCQTELQQQLIHAPEGYKPDFLPSFPRVS---KGNILNGTGGAFQSSGSWYDVTLICQVDNDARKVIS 351 Rhizobi...
WP_012651897         383 wKKLPRRERVSYLCNSEEKLQFGQDLNGMG---FMNSALSQAMRSDTGLFGNGVAVKTPKGWQQVKFTCQVDDDALKVIA 459 Agrobac...
zhongguo:SL003B_1267 264 MAGMPAGDRLNLLCMTELRAQLNAAAPPRRPEILPSFRPQ----AGTVLEPRQAAFRSAGEWYDLAFRCEVDPGVTKVVK 339 Polymor...
Q1QRS6                32 LGKLDPQTRLEQICDLAAVKHIGKSGKLPKPDRAKSNVITPPRHHGDTIVANGGAFRSGGKWYAFSFKCKGSPDHLDVLS 111 Nitroba...
WP_013912710          30 LKRLDPATRLEQVCDVEAMKQITRDDNPYRPDRAKSYVVSPPRHIGDTVKGTGGAFRSGGKWYTYSFTCKGSPDHFKVLS 109 Oligotr...
Q2KAV4               109 LDYQIGEKVPREKWDKYYL 127 Rhizobium etli CFN 42
Q7CXQ3               338 FRFKIGDVITPAEATKRGF 356 Agrobacterium fabrum str. C58
vbi:Avi_3101         344 FSYSLGAAVPKSQWQARRF 362 Agrobacterium vitis S4
jgi:Oant_4161        273 FSYNIGRAIPEREWARRQL 291 Ochrobactrum anthropi ATCC 49188
goetting:NGR_b20370  291 FSFAIGGAIPKSEWGLRQL 309 Sinorhizobium fredii NGR234
Q2K621               352 FRFDVGDKIPKSQWKSRGF 370 Rhizobium etli CFN 42
WP_012651897         460 FSHAVVGRIPQSQAEKLGL 478 Agrobacterium
zhongguo:SL003B_1267 340 FGLRVGAAIPRSQWQQRGF 358 Polymorphum gilvum SL003B-26A1
Q1QRS6               112 FTYRVGAMIPKSKWPEYGL 130 Nitrobacter hamburgensis X14
WP_013912710         110 FTYKIGQPIPEKKWASYGL 128 Oligotropha carboxidovorans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap