4ESJ


Conserved Protein Domain Family
DpnI

?
pfam06044: DpnI 
Click on image for an interactive view with Cn3D
Dam-replacing family
Dam-replacing protein (DRP) is an restriction endonuclease that is flanked by pseudo-transposable small repeat elements. The replacement of Dam-methylase by DRP allows phase variation through slippage-like mechanisms in several pathogenic isolates of Neisseria meningitidis.
Statistics
?
PSSM-Id: 399203
Aligned: 15 rows
Threshold Bit Score: 260.335
Threshold Setting Gi: 530554166
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4ESJ_A           4 MELHFNLELVETYKSNSQKARILTEDWVYRQSYCPNCGNNpLNHFENNRPVADFYCNHCS----------EEFELKSKKG 73  Streptococcus...
jgi:Sdel_1531    1 MNLHFNRSLIQEYKNSSQIARVLTENWVEKNIFCPSCGTP-IQSYENNRPVADFYCLTCK----------EQFELKSKKG 69  Sulfurospiril...
Q73N87           1 MIYRFDISLIKKYHSKSQIVRVLTEDWVLRNFNCPICGKLkIEAYPNNYPAGDFFCKNCK----------SDFELKSKES 70  Treponema den...
jgi:Amuc_1564    1 MDLFFNNNVTEGYKNHSQIARRLTEDWVERNMFCPICGHSvLNHYQNNKPVADFYCCCCH----------SDFELKSLKS 70  Akkermansia m...
EQB65564        13 L---------REYKSPSQIARNVTEKWAKDNLYCPKCGSQ-LKQHRNNTEVYDFFCDHSNqefilfptqlEEFQLKSTKS 82  Thermoplasmat...
CCY70505         1 MNLQMDRRKAENYSSNAQKIRVMTENWVDKNMFCPYCGNPyVSHFENNRPVADFFCPSCM----------EEYELKSKGT 70  Eubacterium s...
CDC02967         1 MNYNFNLSLIENYKSNSQKIRVMSETWLAENVYCPYCGNShLSKFANNKPVADFYCDSCG----------EVFELKAKEN 70  Eubacterium s...
Q5FAK4           1 MNLFFDTQLGKQQNKATHKIRVMSEAWLEKNGYCPCCGSKpMQRFANNKPVADLFCPNCH----------EQYELKSKNQ 70  Neisseria gon...
CCY65281         1 MNLFFDNKICLKYKSASQVARIVTEYWLAQNMFCPICGAPlLHQYTANKPVADFYCDLCK----------SDFELKSYKS 70  Prevotella sp...
jgi:Calni_0428   3 MNINLNTNIAANYRSNTQKIRVITEYWVKQNGYCPNCGNKlLS-FANNRPVSDFFCDNCK----------EEFELKSKKG 71  Calditerrivib...
4ESJ_A          74 ----NFSSTINDGAYATMMKRVQADNNPNFFFLTYTk-NFEVNNFLVLPKQFVTPKSIIQRKPLAPTANRAGWIGCNIDL 148 Streptococcus...
jgi:Sdel_1531   70 ----SLGKKVTDGAYDTMIARLKSSENPNFFFLTYElkTLQIHNFVVMPKHFFTPEIIEKRKPLSPNAKRAGWVGCNILL 145 Sulfurospiril...
Q73N87          71 is-gKLPNIITDGAYKTMIERITSYRNPNFLFLTYK--DYEVSNFILIPNHFFTPSIILKRKPLSNTARRAGWIGCNIDI 147 Treponema den...
jgi:Amuc_1564   71 sn-kILSKKINDGAYDTMISRIKSYNNPNFFFMNYA--DGAVNNLWLIPNHFFIPAIIEKRPPLSANAKRAGWTGCNILL 147 Akkermansia m...
EQB65564        83 fpynGFPKKIVGSGYDAAQRRLDSGMFPSLILLHYQrkAEEVRDGLLIHRLSIPPSSIRPRKPLSNNARREGWRGYEIIM 162 Thermoplasmat...
CCY70505        71 ----SISNKVNDGAYNTMIERITSVNNPNFFFMHYNktNLQIENFVMVPKYFFSPDIIEKRKPLSDTARRAGWTGCNILL 146 Eubacterium s...
CDC02967        71 ----NIGKKITDGAYSTMIERITSISNPDLFVMQYTk-EYQVLNLLVVPKFFFTPEIIEKRKPLSENARRAGWIGCNILI 145 Eubacterium s...
Q5FAK4          71 k---TIGNSVPDGAYRTMLERIRSDTNPNFFFLAYKkaDYSIRQLVLVPKHFITPDMIIPRN--KGIKNRPHHIMCSINL 145 Neisseria gon...
CCY65281        71 ne-gKIKHKITDGAFRTMIERITSLKNPHLFVMSYA--NMEINNLLLIPKFFFTPNIIEKRPPLKETARRAGWIGCNIEI 147 Prevotella sp...
jgi:Calni_0428  72 a---EIGMKIVDGAYSSMLNRITSERNPHFFFLTYDktKMTVVNFFIIPNFYFTPEIIEKRNPLTPTAKRSGWIGCNINL 148 Calditerrivib...
4ESJ_A         149 SQVPSKGRIFLVQDGQVRDPEKVTKEFKQGLFLRKS 184 Streptococcus pneumoniae TIGR4
jgi:Sdel_1531  146 SALPESGKIFYIHNQTIQSKDAILEKWAKTLFLKES 181 Sulfurospirillum deleyianum DSM 6946
Q73N87         148 SKIPDAGKIFIIKDQIETDSKEIINKYAKIKSLKKT 183 Treponema denticola
jgi:Amuc_1564  148 SEIPESGKIQIIKNSIVIEKEEILAKYKRTKSLLTK 183 Akkermansia muciniphila ATCC BAA-835
EQB65564       163 QRIPYMGRIPFIEEGKVTEKETVLAKWKYVENIMEG 198 Thermoplasmatales archaeon I-plasma
CCY70505       147 GRIPEEGRIYIVQNEKEVSIEKIIEKVHKTEFLRGS 182 Eubacterium sp. CAG:161
CDC02967       146 SDIPKQGKILIVDRQHLRNKEDVINDYKLIKNMQTN 181 Eubacterium sp. CAG:202
Q5FAK4         146 APLPESGKIFLIDDSRIIEPETVLKKWQSNLFLRNQ 181 Neisseria gonorrhoeae FA 1090
CCY65281       148 GNIPEIGKIYIIKNKEEINKADVIKQYQQVLNLQTS 183 Prevotella sp. CAG:1124
jgi:Calni_0428 149 SLIPEMGKVFYVKNSITFSKYEVLHDWEKTQFLKTE 184 Calditerrivibrio nitroreducens DSM 19672
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap