Conserved Protein Domain Family
Peptidase_C93

?
pfam06035: Peptidase_C93 
Bacterial transglutaminase-like cysteine proteinase BTLCP
Members of this family are predicted to be bacterial transglutaminase-like cysteine proteinases. They contain a conserved Cys-His-Asp catalytic triad. Their structure is predicted to be similar to that of Salmonella typhimurium N-hydroxyarylamine O-acetyltransferase, in pfam00797, however they lack the sub-domain which is important for arylamine recognition.
Statistics
?
PSSM-Id: 399198
Aligned: 44 rows
Threshold Bit Score: 211.678
Threshold Setting Gi: 81738981
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Snov_2022           26 ANTGVPIGYARFCTENARDCGAGPSGHADggkVVLTEANFAQLRQVNEDVNRRIEPMTDLDHY-----GEV-ER-WAYPA 98  Stark...
vbi:Arad_2041           43 IRTTVPIGWISFCDAQPAECAAGQKSEEF---AKVDEDRRAELLQINQLVNHEIQGVGDDDHYgiyklGIM-NW-WTYPD 117 Agrob...
jgi:Msil_0957           45 SVTSVPFGWADFCRRYQGVCDGGAIEPLD---VVAAPKTMREIERVNKWVNAHIVAITDKEHW-----GVL-DQ-WDYPA 114 Methy...
WP_013948523            42 GAVAPPAAFVRFCTESPSECVLRKAGNG----FAESAKRLEQLDEVNRRINRAITPMTDIEHY-----GIE-DY-WTIPK 110 uncla...
WP_013947731            43 GSSQPPYGFVAFCERMPQECVVTSSDDAR---FRATPQALSELDEINRSVNHEIEPATDQEVY-----GVT-EY-WTIPK 112 uncla...
PRJNA229194:W911_12305  41 GPAQPPYGFVRFCERNPDACRARHIEDIR---FQPTPERLSELDEVNRWVNHAIAPATDMEIY-----GVS-EF-WTFPV 110 Hypho...
goetting:NGR_c19800     29 GKAFAPPAFASFCTREPKLCSTKGGAKT----VALRPDKASELQQVNRAVNARIRERSDIANV-----GKD-DD-WRVPA 97  Sinor...
WP_012030467            46 EPTLAPMAYTMFCMRYSDECANRPRMIFRggaTRLTKDRLAQLVEVNAQVNRQIVPQRNER-------GLAgEE-WLIGP 117 Brady...
Q6N4H9                  59 APTLAPFQHVRFCIRYPLDCASDRDQTDR---VELSPSTLKLLEAINRSVNSEIAPIQK--VY-----GSDlKIgWTISP 128 Rhodo...
Q89SN6                  42 DNALAPLQFVKFCMNYDAECAADTAERT----LPSGERAMSMLREVNSSVNASITPMQKST-------NPMvAR-WTLAP 109 Brady...
jgi:Snov_2022           99 DgYGDCEDYVLLKRRTLIGLGWPADTLLVTVVRDHKGDGHAVLTVVTDRGDLVLDNQEAAVLLWHETGYRFVKRQAQDDG 178 Stark...
vbi:Arad_2041          118 DgMGNCNDYVLLKRKLLIEAGWPRSALLLTVVLDKHNEGHLVLMARTNDGDLVLDNLTDAVKTWSGTGYTYIKRQSADDP 197 Agrob...
jgi:Msil_0957          115 DgKGDCEDFALLKRKILIEEGFPRQALLMTVVKDQSNEGHAVLTIKTSNGDFVLDNLAPDVKSWSRTPYRFVKRQSQADQ 194 Methy...
WP_013948523           111 DgKGDCEDYALLKRHILISLGWPTSSLLMTVVRIENGEGHAVLTARTKFGDLILDNRTDDLKPWYQTGYSYKMIQSSNDP 190 uncla...
WP_013947731           113 T-RGDCEDYALLKRHRLIASGWPSGTLLMTVVRDEKNEGHAVLTARTTQGDFILDNKIDVVRLWNQTPYHYVMRQSYLNP 191 uncla...
PRJNA229194:W911_12305 111 D-RGDCEDYALLKQKILIQRGWPKSSLLLTVVRDEKGEGHAVLTARTSQGDFVLDNKIDDVRLWNASGYYFLMRQSYLDP 189 Hypho...
goetting:NGR_c19800     98 g-YGDCEDFAILKKRELLKRGWPASALLLTVAR-YHGAGHTVLTVRTSEGDLVLDNMTNSVRDWSRTPYDYFARQSQSNG 175 Sinor...
WP_012030467           118 A-RGDCNDYAVTKRHELLVRGWPMRNLLLSEVVTSWGEHHLVLVVRVKEGDLVLDNLNAQIRSWSKSNYRWVRSQTPANP 196 Brady...
Q6N4H9                 129 K-AGDCNDYAVTKRHRLIESGLPARALRLSVVRTPDQIGHLVLLVSTTDGDLVLDNLTPSIRSWQNTDYEWLKIQSRADA 207 Rhodo...
Q89SN6                 110 S-AGDCNDYAVTKRHQLIEMGWPRSALRLAVVLT-GGRGHLVLVARLADGDFVLDNLSASVRPWNAADYEWISMQSGGNP 187 Brady...
jgi:Snov_2022          179 DKWVSLGDV 187 Starkeya novella DSM 506
vbi:Arad_2041          198 NVWLRLEPG 206 Agrobacterium radiobacter K84
jgi:Msil_0957          195 NVWVQIGDP 203 Methylocella silvestris BL2
WP_013948523           191 QVWRDLDPD 199 unclassified Hyphomicrobium
WP_013947731           192 KVWVSLDPN 200 unclassified Hyphomicrobium
PRJNA229194:W911_12305 190 RVWVSLDVN 198 Hyphomicrobium nitrativorans NL23
goetting:NGR_c19800    176 SRWERIGGA 184 Sinorhizobium fredii NGR234
WP_012030467           197 NHWAAVAQi 205 Bradyrhizobium sp. ORS 278
Q6N4H9                 208 RLWSDVGRK 216 Rhodopseudomonas palustris
Q89SN6                 188 QFWVAIGEH 196 Bradyrhizobium japonicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap