Conserved Protein Domain Family
DUF919

?
pfam06034: DUF919 
Nucleopolyhedrovirus protein of unknown function (DUF919)
This family consists of several short Nucleopolyhedrovirus proteins of unknown function.
Statistics
?
PSSM-Id: 114740
View PSSM: pfam06034
Aligned: 19 rows
Threshold Bit Score: 61.0974
Threshold Setting Gi: 82027124
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9J812    75 SKDESLRQKLNQILQTKKQLSIQMQHWERIKRITKDPQEVANIDEKLFRMRMEFLKFSTNNF 136 Spodoptera exigua multiple nucleopoly...
Q0N480    19 SQNDSLREQLNAIVAAKKNLNIKMQHWEKLKRITKDPQEIAAIDSELNKLRMEFLSFSVKKF 80  Clanis bilineata nucleopolyhedrovirus
ALR70872   8 DNGQSLTKQLDKINEHKRKIAVESQHFEKIYKLTKNTSELKNLEHRVMESRQNFLNFGVKHF 69  Anticarsia gemmatalis multiple nucleo...
Q91BJ0    25 TTCTTLERQINDIVATKRRLKIKMQHLERLKLITKNEIERRDLDRRLFEIRMNFLEYAHLKF 86  Spodoptera litura nucleopolyhedrovirus
Q8V5W5     6 KKNLNIAQQLYDITQAKRQLTIKQTHYERLKRITKDAKELQEIEQQLHQIRMDFLKYSTTMF 67  Helicoverpa zea single nucleopolyhedr...
A0EYS0    18 NRQPDVRQQYQHVMQMKRRLEIQTSHDEKLKRLTKCPKEIERLNDKINTARINFLNYGVNNF 79  Ectropis obliqua nucleopolyhedrovirus
P87579    17 NKQQSLKSQLDELNRIKHQARVKLSHEERLLKMEKYP---QQQENRLNALRNDYLKKIVDRL 75  Cydia pomonella granulovirus
Q9YMT5     7 DCNQCLREELNRIIQTKKRLAIKMEHWERIRRITKNARELREIDRTLAEMRMEFLKFGEKHF 68  Lymantria dispar multiple nucleopolyh...
ABM45840  33 SKDESVRQKLNEIVMAKKQLSIQMQHWERIKRITKDQKEIAEIDDKLHKMRMEFLNFGSTNF 94  Spodoptera frugiperda multiple nucleo...
Q8QL77    20 SKDEDLRRQLNQILQAKRQLTIQMEHWERIKRITKDPKEVQDIESKLLKMRMDFLNFSTDKF 81  Mamestra configurata nucleopolyhedrov...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap