Conserved Protein Domain Family
SERTA

?
pfam06031: SERTA 
SERTA motif
This family consists of a novel motif designated as SERTA (for SEI-1, RBT1, and TARA), corresponding to the largest conserved region among TRIP-Br proteins. The function of this motif is uncertain, but the CDK4-interacting segment of p34SEI-1 (amino acid residues 44-161) includes most of the SERTA motif.
Statistics
?
PSSM-Id: 399196
Aligned: 30 rows
Threshold Bit Score: 47.9113
Threshold Setting Gi: 47216746
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_005025609  39 VLNMCLTKLQTYKMLVEPNLHRSVLIANTVRQIQEE 74  mallard
XP_001507850  43 LLDMSLVKLQLCHMVVEPNLCRSVLIANTVRQIQEE 78  platypus
XP_005991698  36 VLNISLDKFQQGQMMVEPSLRRSVLIANTLRKIQEE 71  coelacanth
XP_005991677  39 LLNMSLYKLHQSLAHVEPNLRHLVLVANTLRLIQEE 74  coelacanth
XP_008112020  28 LFSLSVSKLHQSLQNVEPNLRHLVLVANTLRRIQGE 63  green anole
XP_002938850  41 LMNISLVKLHRSLHHVEPDLRHLVLVANTLRRLQGN 76  tropical clawed frog
XP_026267344  55 LFDLSVIKLHHSLRQSEPDLRHLVLVVNTLRRIQAS 90  Arctic ground squirrel
XP_026803957  75 VLDLCLDKLQSCQRRAEPSLHRSVLLANTLRQIQQE 110 striped catfish
4_pfamImport   1 VLGLCMEKLQGQQAGAEPSLRRCVLLANTLRQIQVD 36 
XP_028250484  69 VLGLCLEKLQRYQAGMELSLRRSVLLINTLRQIQEE 104 Indian glassy fish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap