Conserved Protein Domain Family
AlkA_N

?
pfam06029: AlkA_N 
AlkA N-terminal domain
Statistics
?
PSSM-Id: 399194
Aligned: 52 rows
Threshold Bit Score: 96.4857
Threshold Setting Gi: 151362785
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9ZBT8            215 PLRLAHRGPYQAGPVFDLLQREAVTGVEEVSGETgrrlYRRTLRLPY----G-----TGIVAVQERPGRagtgsgGWLEA 285 Streptomyc...
jgi:Pmen_1888       5 TLLLPYQPPWDWQQFHSHFALRAIPGLEALSADS----YSRGFCIDG----A-----PGWLRVAPLPGQ------NALEL 65  Pseudomona...
mgcchina:PST_2427   4 TIHLPYLEPWDWQQFHRHFALRLLPGVERLDLRG----YARTLRLGD----A-----RGWLGVSAADDR------PALEL 64  Pseudomona...
WP_012158028      196 TLVLSYRPPYHWEDMLRFLAGRAITGIEVVKNNE----YMRTVHLEN----SegkpvYGWIRVGHQSKR------NALSV 261 Alkaliphil...
Q8XWG9            197 TLMLGYRPPFAWHALLDFLRARAVDGVEVVDAHS----YARTIALDYagrrH-----AGWLRARDVPQR------HAIAL 261 Ralstonia ...
Q1LAQ5            195 VFELGYRPPMAWGALLGFLAVRAVDGIEQCDGEV----YSRTLSIEAggrcH-----AGCVRLEHVARR------AVLRI 259 Cupriavidu...
wugsc:KPN_02520     1 mvLLPWTPPYDWAWMVGFLQARAVAGVERFHDGG----YSRSFGVEG----H-----RGLIHLAPDEEA------QGLRV 61  Klebsiella...
Q8ZNQ5              1 mFTLSWQPPYDWSWMLGFLAARAVDGVETVGEGF----YARSLVVGE----H-----RGLVSVRPHLPT------HTVQV 61  Salmonella...
Q2SDC7            199 SFEMPYRPPYAWDALLSFLSARTIAGVDAVVDGr----YHRIVRVEA----Geds-avGWFEASHEADA------ARIRI 263 Hahella ch...
Q6MA41            193 TLQLNYRPPYDWIGFLNFLSIRSLKGIELVKNNC----YLRTVQIRE----Y-----KGWIHVSHVEDK------HCLRV 253 Candidatus...
Q9ZBT8            286 RLHLTDLRDLTTSVQRLRRLFDLDADPYAVDERLGADPRLAPLVAARPGLRSPGTAD 342 Streptomyces coelicolor
jgi:Pmen_1888      66 RCRIASPAHLDPLEQRVRRMFDLDSEPETIARHLSADELLAPLLLRNPGLRLPVAFD 122 Pseudomonas mendocina ymp
mgcchina:PST_2427  65 TLSDSLRHASQPLVARVRKMFDLDADPQVIAAHFAGDPALGPLVSAQPGLRLPAAYD 121 Pseudomonas stutzeri A1501
WP_012158028      262 TVSQALLSVLPQVLARIRHLFDLYCDPDAVYETLQVMNDIRPNLCTL-GTRVPGCFN 317 Alkaliphilus oremlandii
Q8XWG9            262 TLSASLVQAMPPVLARVRRLFDLDCRPDLVDTHL------GTLAAGTPGLRVPGAVD 312 Ralstonia solanacearum
Q1LAQ5            260 TLSGALAPVIPQALGKVRRLCDLGCRPDIVDAHL------GELAARTPGMRLPGAFD 310 Cupriavidus metallidurans CH34
wugsc:KPN_02520    62 TLSPGLQPVAEICYARIGQLFDLACDPRQVARTL------GDLAQARPGLRLPGALD 112 Klebsiella pneumoniae subsp. pneu...
Q8ZNQ5             62 SVSAGLLPVAPACLAKVSRLFDLDCQPAQVAAVL------GPLGEDRPGLRLPGSVD 112 Salmonella enterica subsp. enteri...
Q2SDC7            264 RLDSTLSRHIGYLINRLRAFFDVSCVPQEINKVL------GTLAQNEPGMRIPSGMD 314 Hahella chejuensis KCTC 2396
Q6MA41            254 KIASSLVPVLAILLERIRNFFDLNARPDKISVQLEQDPFLAEEVAKNPGLRVPGTFD 310 Candidatus Protochlamydia amoebop...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap