5LNH


Conserved Protein Domain Family
CodY

?
pfam06018: CodY 
Click on image for an interactive view with Cn3D
CodY GAF-like domain
This domain is a GAF-like domain found at the N-terminus of several bacterial GTP-sensing transcriptional pleiotropic repressor CodY proteins. Presumably this domain is involved in GTP binding. CodY has been found to repress the dipeptide transport operon (dpp) of Bacillus subtilis in nutrient-rich conditions. The CodY protein also has a repressor effect on many genes in Lactococcus lactis during growth in milk.
Statistics
?
PSSM-Id: 399189
Aligned: 17 rows
Threshold Bit Score: 214.049
Threshold Setting Gi: 81537562
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5LNH_K   1 ALLQKTRIINSXLQAA----AGKPVNFKEXAETLRDVIDSNIFVVSRRGKLLGYSINQQIENDRXKK-XLEDRQFPEEYT 75  Bacillus subtilis sub...
Q834K5   3 TLLEKTRQVNELLQKNnlfdVQAELPYNKMAMILGDILESNAYIISSSGDLLGYTEKLDVNNARIKN-MFKEKKFPQGYT 81  Enterococcus faecalis
Q8XJQ5   3 TLLSKTRRLNKILQKS----GTEAIAFGDICQLLSDVMSCNVYLVGRKGRILGYSFSEKFECDIMKEkVVVDRKFPEDYN 78  Clostridium perfringe...
Q895L3   3 SLLEKTRQLNKILQKS----GAEPVVFDDICNLLSEVLSCNVYIISKKGKILGYDLSTGFECQTVRDkVVPEKRFPEHYN 78  Clostridium tetani E88
Q8R9Y4   2 TLLEKTRKLNRILQKT----GIQPVDFMEMASILKEVIEANVYILSRKGKVLGYSALKDYGDEI----FAKDKAIPEEYN 73  Caldanaerobacter subt...
Q67PC4   3 TLLEKTRRINRLLQKS----AGTQVNFNELAGVLADLIGADVYVASRKGNIVGLGLTAGDAD------AYQNITFTEEYN 72  Symbiobacterium therm...
Q8DP01   3 HLLEKTRKITSILKRSee-qLQDELPYNAITRQLADIIHCNACIINSKGRLLGYFMRYKTNTDRVEQ-FFQTKIFPDDYV 80  Streptococcus pneumon...
Q9CJ45   3 TLLEKTRKITAILQDGvt-dLQQELPYNSMTERLANVIDCNACVINTKGELLGYSLPYNTNNDRVDQ-FFYDRKLPDEYV 80  Lactococcus lactis su...
P63847   3 NLLEKTRKITSILQRSvd-sLDAELPYNTMAAQLADIIDCNACIINGGGNLLGYAMKYKTNTDRVEE-FFETKQFPDYYV 80  Streptococcus agalact...
Q5M305   3 NLLDKTRKITSILQRSvd-sLEGDLPYNNMAAQLADIIDCNAAIVNGGGALLGFAMKYKTNNDRVEK-FFKAKQLPEEYI 80  Streptococcus thermop...
5LNH_K  76 KNLFNVPETSSNLDINSEYTAFPVENRDLFQAGLTTIVPIIGGGERLGTLILSRLQDQFNDDDLILAEYGATVVGXEILR 155 Bacillus subtilis sub...
Q834K5  82 EAVDMLKVTEANIPIDSDLTAFPFESRELYPFGLTTIVPLYGAGKRLGTIILARVEKSFNEDDLVLAEYSATVVGMQILY 161 Enterococcus faecalis
Q8XJQ5  79 NKLINIQDTIANIP-NKGICVFEGVGECLISKKISTIVPIVGNGDRLGTLLLARFGEEFNDDDLVLAEYSATIVGMELLR 157 Clostridium perfringe...
Q895L3  79 NKLLNVHGTKSNLE-NQGECVFESGEDCGVKNKLTTIVPINGNRERLGTLLLARFDVPFTDDDLIISEYSATIIGLEILR 157 Clostridium tetani E88
Q8R9Y4  74 DRLLRVTETLAN----DKGKLFKEEKA--LADLIVTVVPINGGGDRLGTLLLIRSTKEFTDDDLIIAEYGATVVGLEILR 147 Caldanaerobacter subt...
Q67PC4  73 SSLMKVDDTTANTE-QSELTVLQEGREVQMRGGRVTIVPVNGGGERLGTLVLVK-SADLTDEDLILGELAATVAGVEILR 150 Symbiobacterium therm...
Q8DP01  81 QGANMIYETEANLPVEHDMSIFPVESRDDFPDGLTTIAPIHVSGIRLGSLIIWRNDKKFEDEDLVLVEIASTVVGIQLLN 160 Streptococcus pneumon...
Q9CJ45  81 RAAVRIYDTMANVPVDRPLAIFPEESLGDFPKGVTTLAPIYGSGMRLGTFIMWREDGEFTDDDLVLVELATTVIGVQLSN 160 Lactococcus lactis su...
P63847  81 KSASRVYDTEANLSVDNDLSIFPVETKENFQDGITTIAPIYGGGMRLGTFIIWRNDKEFSDDDLILVEIASTVVGIQLLN 160 Streptococcus agalact...
Q5M305  81 RGISRVYDTQENIGIDSDLTIFPVELKDDFPDGLTTIAPIYGGGMRLGSFIIWRNDHDFVDDDLILVEIASTVVGLQLLH 160 Streptococcus thermop...
5LNH_K 156 EKAEEIEEEARSKAVVQXAISS 177 Bacillus subtilis subsp. subtilis str. 168
Q834K5 162 HQSRTIEAEVRSATAVQMAINT 183 Enterococcus faecalis
Q8XJQ5 158 ARQGEIEEEARKKAVVQLAIGT 179 Clostridium perfringens str. 13
Q895L3 158 SKQDEIEEEARKKAVVQLAIGT 179 Clostridium tetani E88
Q8R9Y4 148 AKNEEIEEEARKRAVVQMALAT 169 Caldanaerobacter subterraneus subsp. tengcongensis MB4
Q67PC4 151 AHAGELEEEARKKAAVQIALAT 172 Symbiobacterium thermophilum
Q8DP01 161 FQREEDEKNIRRRTAVTMAVNT 182 Streptococcus pneumoniae R6
Q9CJ45 161 LKLEQMEENIRKDTMATMAVNT 182 Lactococcus lactis subsp. lactis Il1403
P63847 161 LQTENLEENIRKQTAVTMAINT 182 Streptococcus agalactiae 2603V/R
Q5M305 161 LQTENLEETIRKQTAINMAINT 182 Streptococcus thermophilus LMG 18311
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap