3H6P,3FAV,4IYI,3FAV


Conserved Protein Domain Family
WXG100

?
pfam06013: WXG100 
Click on image for an interactive view with Cn3D
Proteins of 100 residues with WXG
ESAT-6 is a small protein appears to be of fundamental importance in virulence and protective immunity in Mycobacterium tuberculosis. homologs have been detected in other Gram-positive bacterial species. It may represent a novel secretion system potentially driven by the pfam01580 domains in the YukA-like proteins.
Statistics
?
PSSM-Id: 399186
Aligned: 86 rows
Threshold Bit Score: 36.4817
Threshold Setting Gi: 1099384216
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3H6P_D          3 QIMYNYPAMMAHAGDMAGYAGTLQSLGADIASEQAVL-SSAWQGDTGITYQGWQTQWNQALEDLVRAYQSMSGTHESNTM 81  Mycobacterium ...
jgi:Haur_2577   4 KTKFDPQVMQQAAATFGKAHEGLQDVNQEVLSIANTL-QESLKGDAGNEFVETLQIMAQSVAKFAAKMTEIQNDIKVSMQ 82  Herpetosiphon ...
3FAV_A          4 EMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSL-QGQWRGAAGTAAQAAVVRFQEAANKQKQELDEISTNIRQAGV 82  Mycobacterium ...
A0QNJ5          3 AMNTDAAVLAKEAANFERISGELKGVIAQVESTGSAL-AAQMVGQAGTAAQAALARFHEAAAKQVQELNEISANIHTSGT 81  Mycolicibacter...
O33084          3 EMITEAAILTQQAAQFDQIASGLSQERNFVDSIGQSF-QNTWEGQAASAALGALGRFDEAMQDQIRQLESIVDKLNRSGG 81  Mycobacterium ...
WP_009943270    3 GFAGDVEIIDKASGQIDEVRGNIEQAVNTLQGQMEPV-LANWKGGASDVFRKLMDAFQENAKKINDKLNELSENVKSSGQ 81  Saccharopolysp...
Q2G182          6 gIKADGGKVDQAKQLAAKTAKDIEACQKQTQQLAEYIeGSDWEGQFANKVKDVLLIMAKFQEELVQPMADHQKAIDNLSQ 85  Staphylococcus...
Q8YAQ4          3 nVKIDAAKVAEAKKSAAIVEKSLESTHKKCKSVISYVeGASWSGKSRDAFLTFMELIEKYHADVKKNYKKQKKALTALED 82  Listeria monoc...
novoz:BL02571   1 -mKISHNGTIKAHSHAKAIEKHVGDSLKKAKELKAYVeSGKWSGKTRDAFLSYLELIIELNADMKDALKEHTAALDALEK 79  Bacillus liche...
Q81B80          5 eveiiGSNTASAISYAQNIENGMKDSLNQAKDLKAYVtGAKWNGKTRDAFLSYLDLIIQYNSEMVEAFEGHTKALKELDK 84  Bacillus cereu...
3H6P_D         82 AMLARD 87  Mycobacterium tuberculosis
jgi:Haur_2577  83 QMADTD 88  Herpetosiphon aurantiacus DSM 785
3FAV_A         83 QYSRAD 88  Mycobacterium tuberculosis H37Rv
A0QNJ5         82 QYTSTD 87  Mycolicibacterium smegmatis MC2 155
O33084         82 NYTKTD 87  Mycobacterium leprae TN
WP_009943270   82 DYAQRE 87  Saccharopolyspora erythraea
Q2G182         86 NLAKYD 91  Staphylococcus aureus subsp. aureus NCTC 8325
Q8YAQ4         83 YVEDFE 88  Listeria monocytogenes
novoz:BL02571  80 Hidgfs 85  Bacillus licheniformis DSM 13 = ATCC 14580
Q81B80         85 SIQTyg 90  Bacillus cereus ATCC 14579
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap