Conserved Protein Domain Family
DUF908

?
pfam06012: DUF908 
Domain of Unknown Function (DUF908)
Statistics
?
PSSM-Id: 399185
Aligned: 95 rows
Threshold Bit Score: 121.666
Threshold Setting Gi: 74953138
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ERT03450      120 ADAQLILAVLKFTRNLLQHCGNRSIYASSSHLSSLLNSSSLQILKASLHVGHELAL--RYHASYKRTSTTSRAFHSALLQ 197  Sporothrix sc...
CCD26361        4 KDEKVCVTLMEFIERLLTNTADMQYYDYLGTINSFLNCPTYKIKYHVLKIMSINAF--RTVKAHQSIMTKPPFNDPI--- 78   Naumovozyma d...
XP_002180633  117 SCYPHLYILLRFLEGLLRNSTSKSIFNSAEELVDLLAAADDETSDLALTALLALSLppALHKQQAPEVQQHTTTLHNAKM 196  Phaeodactylum...
XP_004962562  108 LPKNTILKILRVMQIVLENCHNKSSFAGLEHFKLLLASSDPEIVVAALETLAALVK-----------------INPSKLH 170  foxtail millet
EEU04085      129 NDKEFIILIIKFTRSLLRNCINSNLFNSSDELNSLFTFPDYDILIELFKFFNVLFSkkKFVKDNSSFIQT---------- 198  Dictyostelium...
EFA84030      104 HDKQLILQLVKCTRFIISSCSNGNHYQSSEELLQLFSFHDYDISNEILKLLSILLItpKYTRECVFFIHNN--------- 174  Heterostelium...
Q8IB94        177 D--LLVEEILRFTYNILDNCLNKTKYNSIEHLILLLWSFNPKLSILCAEILNIYYLfiKKTKKNET-------------- 240  Plasmodium fa...
XP_002258060  139 D--LLIEEILRFTYHILDNCLSKSKYNSLDHLLVLLWSFNPKISILSAEILNIYYLfiKKTKKNEN-------------- 202  Plasmodium kn...
Q7R7Z1        109 D--QLIEEILRFTYCILDNCLNKSKYNSLDHLLTLLWCFNPKISILSAEILNIYYLfiKKTKKNEN-------------- 172  Plasmodium yo...
EDO06876       93 DLLSLVRTVLKASVMIVENCTSKSVYNSVDLLISFLDDVDPDIVFLSTKLLCVYFS---RQRRNTTPKDVPEVSARIALL 169  Babesia bovis
ERT03450      198 NHYDM------------SLD--------RVQQLALPFVKTPLSGSLASTAPFGnsaptlqrtpstpapgasssaaaaaap 257  Sporothrix sc...
CCD26361       79 -----------------LRT--------NLLKVALALPSSVPDDDGDH-------------------------------- 101  Naumovozyma d...
XP_002180633  197 PSHS------------------------RLTAIARGWGTR---------------------------------------- 212  Phaeodactylum...
XP_004962562  171 MNGKLisc-------gaINT--------HLLSLAQGWGSK---------------------------------------- 195  foxtail millet
EEU04085      199 -----------------IIP--------KLSIISSGFN------------------------------------------ 211  Dictyostelium...
EFA84030      175 -----------------LGP--------RLKILAAGFP------------------------------------------ 187  Heterostelium...
Q8IB94        241 -----------------KIN--------EIVNFVSSIINIPIPDHLHPYINND--------------------------- 268  Plasmodium fa...
XP_002258060  203 -----------------KIN--------QIVNILSALINIPVPSFLHPYINND--------------------------- 230  Plasmodium kn...
Q7R7Z1        173 -----------------KIN--------EIISSLSALINIPIPNFLHPYINID--------------------------- 200  Plasmodium yo...
EDO06876      170 SQSPFpdatchvyktvsKSNdhcsaertSVSELSENFASVSYSD------------------------------------ 213  Babesia bovis
ERT03450      258 pappstgkgkekahgessKAITTMYSNDFVSIATdgpasaaptd-----attsasdasSWSSWGDIKITYYPQHKSRQQD 332  Sporothrix sc...
CCD26361      102 --------------------------FSLIDLFTekk--------------------kyPSNWTKLKYPYYIQERRNN-- 133  Naumovozyma d...
XP_002180633  213 -----------------------AMGLGLWSVIKaddsv--------------hgqgsLPGEAGRLSVCYYSRESQNEVN 255  Phaeodactylum...
XP_004962562  196 -----------------------EEGLGLYSCVVanegnqqeglslfpadmenkydgsQHRLGSTLHFEYNLSPTQDPDQ 252  foxtail millet
EEU04085      212 -----------------------EDHLHPLSLCKedt--------------------kiPESLNSFNFEFYKSKSKTTVN 248  Dictyostelium...
EFA84030      188 -----------------------ENHMDLLTCCSeel--------------------viPSSITNFTLEFYEKHQQPQLQ 224  Heterostelium...
Q8IB94        269 ------------------IGRIN------------------------------------DNNYISGLVLYYLHDKTNEQY 294  Plasmodium fa...
XP_002258060  231 ------------------IGRIN------------------------------------DNNYISGLVLYYMHDSTDKRY 256  Plasmodium kn...
Q7R7Z1        201 ------------------IGNIN------------------------------------DNNYISGIILYYLHDFSDKKY 226  Plasmodium yo...
EDO06876      214 -----------------------------------------------------------VIDYYVAQNEYYLKTDSYVEI 234  Babesia bovis
ERT03450      333 GLGSDSQELSPgqpqsvh-----drtgyssIPSTPTPLRRASTVG--------SDRtprvsgqaaedaSsPLTHalTRTP 399  Sporothrix sc...
CCD26361      134 ------------------------------------------KASnsittsqtTS---------------AINTstMVLA 156  Naumovozyma d...
XP_002180633  256 EESQMVRIYLNesdimvg-----gsaeismDSTSDALTAESDQVSkk--------------------------------- 297  Phaeodactylum...
XP_004962562  253 TSDKSKSSNLC--------------------------------------------------------------------- 263  foxtail millet
EEU04085      249 TKSTTTTTTTTtt----------------pSSTSPPTSNININSKsiffekitVSTieesg---kviiR----------- 298  Dictyostelium...
EFA84030      225 QQQPPQQQTEQq------------------QPQTPQQSQQQQQQQnvqvnesdRKSf----------vR----------- 265  Heterostelium...
Q8IB94        295 MKNIYNKVENKyfld----------------------------------------------------------------- 309  Plasmodium fa...
XP_002258060  257 MQNVYSKIDNKylly----------------------------------------------------------------- 271  Plasmodium kn...
Q7R7Z1        227 MNNIYSKIENKqlld----------------------------------------------------------------- 241  Plasmodium yo...
EDO06876      235 GQDVTRGHESSklripvidilniyddtlsmKTSSPPNTEGHEKLMadvlawknSL------------------------- 289  Babesia bovis
ERT03450      400 GNAAAGDETAVsgqrYFELPSRVV------------------QS----ST-IYELMARCPA--DMPETARYELLSRIRIA 454  Sporothrix sc...
CCD26361      157 STPVLSSSSLR----KLILNKEDL------------------QK----YT-LQELYNKGME--VLPHKNWFDYSLKVAVA 207  Naumovozyma d...
XP_002180633  298 -------------rrIGKIPRKET------------------KSt---AElYYLVLERAGGmdKIPSDRLFPLLADIRLA 343  Phaeodactylum...
XP_004962562  264 ---------------VIHIPDMHL------------------QK----ED-DLSILKQCVDkfNVPPEHRFALLTRIRYA 305  foxtail millet
EEU04085      299 ---------------LFDIDKINA------------------------TP--YEIASKLIQdyGIPEEDQYFVHFRIGLL 337  Dictyostelium...
EFA84030      266 ---------------FTDIDKRTA------------------AK----ES-LFDIVQSQISkyAMSEDDQFHTYSRVHTA 307  Heterostelium...
Q8IB94        310 ------------lidY-NIDLQKIninvnnidisftslfpthIKynetQNiLNNAFNYIMEnyNIPEQYMYDVRHKLRIY 376  Plasmodium fa...
XP_002258060  272 ------------lvdY-DLNLDNVtinvedheipftsvfpkeVKynnaKDaLQQAYDTIINkyQLDEKKTFDLRHKLRIY 338  Plasmodium kn...
Q7R7Z1        242 ------------linYKEIDLNKIilniddndiqftsifpnqVSynnsKDvLQNAYDKIVNkyNINEKKKYDLRHKLRIY 309  Plasmodium yo...
EDO06876      290 ------------------------------------------STesdlYQhMLKTLRLIMKknKIEACYFAELKYKFCKV 327  Babesia bovis
ERT03450      455 KALLGSEES----RQLALAVRLLAITNLAFIHPETAFLEQVLKQDAEeprrfqLTYQLAELIRPGas------------- 517  Sporothrix sc...
CCD26361      208 KSFSDDSEEnkelRKLIIKTKFMAIALTNCIFVPPQVSAKFFEVDQY------AFNSLTDFISGDe-------------- 267  Naumovozyma d...
XP_002180633  344 RSFHSQAA-----RIGAVERRLRALTTILHAHPSQEVMNGYFQAQPE------LCVEIVDLLRPTvssaniaaasgrate 412  Phaeodactylum...
XP_004962562  306 RAFNSARTCrlysR-----ISLLSFIVLVQSSDAHDELTSFFTNEPE------YINELIRLVRSE--------------- 359  foxtail millet
EEU04085      338 KGLP--NYEy---RKKYMQLRLVATNTLYHQSLINFASNS-TNYNFGgtqdteYLGELMELLKNY--------------- 396  Dictyostelium...
EFA84030      308 QIFG--DVEq---RRKWVQCRLMAINCIQYTTEQQLAQ--IVVDEPD------FVNELMDLIRKY--------------- 359  Heterostelium...
Q8IB94        377 VGLICPKY-----RRKLFNLRYLILSGSLSI--NSIVSPQIVTSNSI------FLEELLYFLKYH--------------- 428  Plasmodium fa...
XP_002258060  339 IGLICPKY-----RKKLFNLRYLIISGSLSI--NSILYPQIIPSNTI------FLQEILYLLKYH--------------- 390  Plasmodium kn...
Q7R7Z1        310 IGLICPKY-----RKQIFNLRYLIICGSLSI--NSILYTQIIPGNNI------FLQEILYILKFH--------------- 361  Plasmodium yo...
EDO06876      328 YSLYFPYL-----QRRLVDIRICALICMVIM--NNTSYTQFLNYNPS------FLHEITQMIRRH--------------- 379  Babesia bovis
ERT03450      518 ---------------kSPVPIWLQSIALQLLES-LAGF---------ASKTNDVMSAVNASVNH--GVLLYVLRKAVA 568  Sporothrix sche...
CCD26361      268 ----------------AKLSTDLKLDALFTLNC-ISSK---------HIWCSDIMRNIGGNMSH--GLLFQILRYLNK 317  Naumovozyma dai...
XP_002180633  413 tnsplqrdaitclsscQPVPYTIRMLAVESLAAlVARRdgstgalsgSARLSTVLAELGIGKGYylGLLPTLLRYSLA 490  Phaeodactylum t...
XP_004962562  360 ----------------DFVPGPIRALAMLALGAqLAAYass----heRARILSGSSIISAGGNR--MVLLSVLQKAIS 415  foxtail millet
EEU04085      397 ----------------TIVPEPILVASIYTMAA-LAS----------TTPTSSLTLLLQRSFSS--GFFSSVIRKCVA 445  Dictyostelium d...
EFA84030      360 ----------------TTVPQDVLIAGIYALSS-LSS----------SYLSSGSTNSLHSALSQ--GFFQSILRKCVA 408  Heterostelium a...
Q8IB94        429 ----------------KYVHFNTLRIIFDLLIT-SIES---------HLYYKVVSDILGLRLHS--GLFISIFKYYLN 478  Plasmodium falc...
XP_002258060  391 ----------------KFVDFSTLHIIFDLLTT-AIES---------HLHYKVVSDILGLRLHS--GLFISVFKYYLN 440  Plasmodium know...
Q7R7Z1        362 ----------------KFINNKTLSIIFDLLTT-AIES---------HIHYKVVSDILGLKLHS--GLFISVLKYYLN 411  Plasmodium yoel...
EDO06876      380 ----------------EELERSTMVILTELLSA-MVYD---------GLHCKTLANLFGLNMPH--GIFSKVLKHYLR 429  Babesia bovis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap