2RD1,3BDU


Conserved Protein Domain Family
DUF903

?
pfam06004: DUF903 
Click on image for an interactive view with Cn3D
Bacterial protein of unknown function (DUF903)
This family consists of several small bacterial proteins several of which are classified as putative lipoproteins. The function of this family is unknown.
Statistics
?
PSSM-Id: 399181
Aligned: 45 rows
Threshold Bit Score: 52.1358
Threshold Setting Gi: 81522793
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2RD1_C             5 YVXTTKNGQTIVTQGKPQLDKETGXTSYTDQEGNQREINSNDVAQLIK 52  Salmonella enterica subsp. enterica serovar...
WP_013792021      25 SVITLNDGREIQTVDRPDFDKDTGFYEFEQLDGKRTKVNKDQVRTVKE 72  Pseudomonas
Q883K7            26 TVITLNDGREIQAVDTPKYDEDSGFYEFKQLDGKQTRINKDQVRTVKD 73  Pseudomonas syringae pv. tomato
Q9I129            25 TIVTLNDGREIQAVDTPRYDRSSGFYELEQLDGKRTRVNKDQVRSIKD 72  Pseudomonas aeruginosa
WP_016492022      25 TVLTLNDGRELQAVDTPEYDDDSGFYEFEQLDGNRAKVNKDQIRSIKE 72  Pseudomonas resinovorans
mgcchina:PST_0678 23 SLIVLNSGQEIQTLDEPKYDAKSGFYEFKQPDGKPQRINKDQVNTIRT 70  Pseudomonas stutzeri A1501
WP_003244529      25 SVITLTDGREIQTVDKPKYDEESGFYEFEQLDGKRATINKDQVQTVKE 72  Pseudomonas
Q9HT47            22 AVVTLQDGSEVLVKDQSDYDKYNDYYEFEQLNGDTILIKKDNVRTIRP 69  Pseudomonas aeruginosa
Q883J1            25 SVVTLQNGTQYITKDMPKTKSRDGFYEFEDLSGKTIRIKADEVATVKP 72  Pseudomonas syringae pv. tomato
WP_012249653      25 STVQTRDGSQLVTPDEPKYNDDTGFYEYEK-DGHKVQINKDDVKSIEE 71  Bordetella petrii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap