Conserved Protein Domain Family
SMN

?
pfam06003: SMN 
Survival motor neuron protein (SMN)
This family consists of several eukaryotic survival motor neuron (SMN) proteins. The Survival of Motor Neurons (SMN) protein, the product of the spinal muscular atrophy-determining gene, is part of a large macromolecular complex (SMN complex) that functions in the assembly of spliceosomal small nuclear ribonucleoproteins (snRNPs). The SMN complex functions as a specificity factor essential for the efficient assembly of Sm proteins on U snRNAs and likely protects cells from illicit, and potentially deleterious, non-specific binding of Sm proteins to RNAs.
Statistics
?
PSSM-Id: 399180
Aligned: 3 rows
Threshold Bit Score: 353.926
Threshold Setting Gi: 82186672
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6P934        16 QSDDSDIWDDTALIKAYDKAVASFKNALKGEDGATPQEND--NPGKKRKNNKKNKSRKRCNAAPDKE--VGDSCYAFWSE 91  zebrafish
Q98SU9        13 QSDDSDMWDDTALIKAYDKAVASFKNALKNGDCSEPSDKQeqRAGVKRKNSKKNRNRNKSNAVPLKQwkVGDSCNAVWSE 92  chicken
NP_001093710  18 QSDDSDIWDDTALIKAYDKAVSSFKKALKNGDCTVSAEAEekIPRTKRKNNKKNRSRKKCNAAPLKKwrVGDTCNAIWSE 97  tropical clawed...
Q6P934        92 DGNLYTATITSVDQEKGTCVVFYTDYGNEEEQNLSDLLTEPPDmded--alkTANVKETESSTEESDRSFtpqksGHAKH 169 zebrafish
Q98SU9        93 DGNVYPATIASINLKRGTCVVTYTGYGNKEEQNLADLLPPASD---------ETNENETPYSTDESEKSS-----QSHHN 158 chicken
NP_001093710  98 DGNIYPATISSIDAKKGTCIVVYSGYGNSEEQSLADLRFPDTSeaesdqreqGQELNGDEHSTDESDRSS-----RSPQC 172 tropical clawed...
Q6P934       170 KSksNFPMGPPS-WFPSFPPGPppPPPHFkkmdGRRGEGP---GPSFPGWPPMIPLGPPMIPPPPPMSPDFGEDDEALGS 245 zebrafish
Q98SU9       159 EN--NCTKARFSpKNLRFPIPP--TPPGL----GRHGSKFrtlPPFLSCWPPPFPAGPPLIPPPPPMGPDSPEDDEALGS 230 chicken
NP_001093710 173 KDsqNREIPKSSqWNGQFPPVPppFMPGF----GRHGEKLdqaHPFLSGWPPPFLPGPPMIPPPPPMSPDACEDDEALGS 248 tropical clawed...
Q6P934       246 MLISWYMSGYHTGYYMGLRQGRKEAAASKKSHRK 279 zebrafish
Q98SU9       231 MLIAWYMSGYHTGYYLGLKQSRMEAALEREAYLK 264 chicken
NP_001093710 249 MLIAWYMSGYHTGYYLGLKQGRMESSFGKSPHQK 282 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap