3P8C


Conserved Protein Domain Family
FragX_IP

?
pfam05994: FragX_IP 
Cytoplasmic Fragile-X interacting family
CYFIP1/2 (Cytoplasmic fragile X mental retardation interacting protein) like proteins for a highly conserved protein family. The function of CYFIPs is unclear, but CYFIP interaction with fragile X mental retardation interacting protein (FMRP) involves the domain of FMRP which also mediating homo- and heteromerization.
Statistics
?
PSSM-Id: 399175
Aligned: 26 rows
Threshold Bit Score: 739.096
Threshold Setting Gi: 121881813
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3P8C_A        389 KLFDLALQGLQLLSQWSAHVMEVYSWK-L------------VHPTDK---YSNKDCPDSAEEYERATRYNYTSEEKFALV 452 
ERN15716       24 NLYDIIVEGFQLLSRWTGRIWEQCAWK-F------------SHPYRNadsQEPREISAAFSDYEKVVRWNYMVEERKALV 90   Amborella tri...
KRG97079      398 nMYDMIVEGFQLLSRWTARIWEQCAWK-F------------SRPCKD--------ASPSFSDYEKVVRYNYSAEERKALV 456  soybean
XP_013628230  398 nMYDMVVEGFQLLSRWTARIWEQSAWK-F------------SRPCRDa--AETQEASGSYSDYEKVVRYNYTAEERRALV 462  Brassica oler...
EEF40433       72 nMYDMVVEGFQLLSRWTARIWEQCAWK-F------------SRPCKDaisSDANGASASVSDYEKVVRYNYSVEERKALV 138  castor bean
EFA78321      387 dvpEVILLGMRILSDWSSRVLQQSAWK-Y------------SKP-------NNDNTIPAQFDYERVVKFNYRPEERVALI 446  Heterostelium...
XP_004366105  389 dVKAIVLLGLRILSDWSSRVLQQSAWK-Y------------SKP-------NNDAAIPAQFDYERVVKYNYSADERVALI 448  Cavenderia fa...
EAY21169      372 QIYDEILHCIQLIGRTKNAVRELLIQK-L------------LYPPDN---------PTIKSPFERSVRIGFSNADLKTVL 429  Trichomonas v...
EAY03832      391 YFMKRIPSSIKILSNAIRTIVELLADKiLnansyeivsnnkAKPGEEq-aEVPAQDPSLISAYERAMRYGFSNFERDSTM 469  Trichomonas v...
EAX87799      397 KLFQELPGILKIISMSMGIVREMIIAKqI------------EAPKID------QNADQNISLYEWAMRRGLTEENSLLIL 458  Trichomonas v...
3P8C_A        453 EVIAMIKGLQVLMGRMESvfNHAIRHTvyaalQDFSQVTLREPLRQAIK--KKKNVIQSVLQAIRKTVCDWETGHEPFND 530 
ERN15716       91 EVVSYIKSIGSMLHQYDTvvADALWETihaevQDFVQNKLAAMLRTTSR--KKKDLSR-ILSDMRTLSADWMANTGKSDS 167  Amborella tri...
KRG97079      457 ELVSYIKSVGSMMQRCDTlvADALWETihsevQDFVQNTLATMLRTTFR--KKKDLSR-ILSDMRTLSADWMANTNKSES 533  soybean
XP_013628230  463 ELVGYIKSVGSMLQRCDTlvADALWETihaevQDFVQNTLATMLRTTFR--KKKDLSR-ILSDMRTLSADWMANT-RPEH 538  Brassica oler...
EEF40433      139 ELISYIKNVGSMMHRCDTlvADALWETihaevQDFVQNTLATMLRTTFR--KKKDLSR-ILSDMRTLSADWMANTSKPEE 215  castor bean
EFA78321      447 QFIAMIKGLGSLMARHESllEPLIKKIihneiQQFVQVQLRETIKSFA---KKKEHIKLELTQLKNLAADWFNGQEPVEA 523  Heterostelium...
XP_004366105  449 QFIAMIKGLGSLMVKHESvlEPIIKRSihgelQQFIQNQLRDTIKSFAKkeKKKDHIKIELAQLKTIAADWLGGSEPVEN 528  Cavenderia fa...
EAY21169      430 HIISLWRSAHDLLRDHFAtiTRLVTLHinrtvQNFIKNELEKILIRCK---KMKDQVEAIISPLRELTGDWMRGEERTGQ 506  Trichomonas v...
EAY03832      470 QILALARTLREIISQNLPklNDMFANAiqnsiQDFIKNKLEPLAKKCA---GKKNYDHSSIENLCLLLQDFSSSRKKHRS 546  Trichomonas v...
EAX87799      459 NILWLAKSTKELLLSNYTtiFQAISDSiqttlQNFAINILPQSILRNQ---EYKDIITNILEVLRTLLGYFPNGMRYEIN 535  Trichomonas v...
3P8C_A        531 -PALRGEKDPKsGFDIKVPRRAVGPSSTQLYMVRTMLESLI-----ADKSG--SKKTL-R-SSLEGPTILDIEKFHRESF 600 
ERN15716      168 gPQSLQQGGEG-SNGNTFHPRAVAPTTAQVHCLQFLIYELVsggnlRKSGGvfGNSG----SEVMPNDLKQLETFFYKLS 242  Amborella tri...
KRG97079      534 eLQSSQHGGEE-SKANIFYPRAVAPTAAQVHCLQFLIYEVVsggnlRRPGGlfGNSG----SEIPVNDLKQLETFFYKLG 608  soybean
XP_013628230  539 eMPSSQHGGDE-SKANFFYPRPVAPTAAQVHCLQFLIYEVVsggnlRRPGGffGNNG----SEIPVNDLKQLETFFYKLS 613  Brassica oler...
EEF40433      216 ---LQSHGGED-SKGSFIYPRSVAPTAAQVHCLQFLIYEVIsggnlRKPGGlfGNSG----SDIPVNDMKQLETFFYKLS 287  castor bean
EFA78321      524 -ANVKKKSTSG-EEKPQIPIRAVPPSSTQLDLILTIVSSLM-----DKK------------KEFSSSQFQELETFHKSAF 584  Heterostelium...
XP_004366105  529 -ANSKKKDE----EKLQIPIRAVPPSTTQLDLILTIISSLM-----NKK------------KEFSSTQFAELETFHNHAY 586  Cavenderia fa...
EAY21169      507 -SNIKNFKD-----HTILDKLAPTPPAT-IEFIRIQVSHMI-----NEGNEllRPVKP-KdRGLGSDDIAAINNFLNASE 573  Trichomonas v...
EAY03832      547 sKATDEEKQ---------EETKSMPHLSFIELMRSQLEQFL-----NQENPvcVHGIA------KSNEEADIKIFLNDSR 606  Trichomonas v...
EAX87799      536 aKKASKVEK------HDVSIDIGTPHIYLIELLRVQLQLLV-----NPDAIavSRQGVfKgQPLDSEDEKIFKEFLDQSS 604  Trichomonas v...
3P8C_A        601 FYTHLINFSETLQQCCDLSQlwfreff-------leltmgRRIQFPIEMSMPWILTDHILETKEA-------------SM 660 
ERN15716      243 FFLHILDYTVTLETLTDLGFlwfref---------ylessRVIQFPIECSLPWMLADYVIETEDG-------------GL 300  Amborella tri...
KRG97079      609 FFLHILDYSATVATLTDLGFlwfref---------ylessRVIQFPIECSLPWMLVDCVLESPNS-------------GL 666  soybean
XP_013628230  614 FFLHILDYSASIGILTDLGFlwfref---------ylessRVIQFPIECSLPWMLIDHILESPNS-------------GL 671  Brassica oler...
EEF40433      288 FFLHMLDYSVTISTLTDLGFlwfref---------ylessRVIQFPIECSLPWMLVDHVLESQNA-------------GL 345  castor bean
EFA78321      585 YYRYLLNISSTVNQITDLADlwyref---------ylelnNRVQFPIETSLPWILTDHILESDDP-------------SL 642  Heterostelium...
XP_004366105  587 FYRYLLNLSATVNQITDLADlwyref---------ylelnNRVQFPIETSLPWILTDHILESDDP-------------SL 644  Cavenderia fa...
EAY21169      574 NFESILLFDEVLIDVGDQSDlyfrev---------qldinNVTAFPIRASLPFVLCEYALSARKSygtekdqhgkvvpEN 644  Trichomonas v...
EAY03832      607 YFADLCNLDEVLEVASDQSSlffkeywldvyrnqvsekvnGAVYFPVTTSLPYILINYAINHASKm------------EL 674  Trichomonas v...
EAX87799      605 YFIELLDLNNTLDKVCDQSFlyykey---------yldlnKRTFFPVNTSIPVILSKYALKNYRKl------------DL 663  Trichomonas v...
3P8C_A        661 MEYVLYSLDLYNDSAHYALTRFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGSLLLDKRLRSECKNQGATihL 740 
ERN15716      301 IESVLIPFDIYNDAAQHALVVLRQRFLYDEIEAEVDLCFDQLVFKLSESIFAYYKSHAASKLLDPAFVFASDNADKYslP 380  Amborella tri...
KRG97079      667 LESVLMPFDIYNDSAQQALVLLKQRFLYDEIEAEVDHCFDIFVTKLCETIFTYYKSWAACELLDPSFLFASDNAEKYavQ 746  soybean
XP_013628230  672 LESVLLPFDIYNDSAQQALVVLRQRFLYDEIEAEVDHGFDIFVSRLSESIFTYYKSWSASELLDPSFLFALDNGEKFsiQ 751  Brassica oler...
EEF40433      346 LESILMPFDVYNDSAQQALVMLRQRFLYDEIEAEVDHCFDLFVSKLSEIIFTYYKSWAASELLDPSFLFALDNGEKYsvQ 425  castor bean
EFA78321      643 IEYIFYPLGLYNDTAHRALQSLNQRFLYDEIEAELNLCFDQLLYKLSGKIYTHFKTTASNILLDKSYKQQLETFHFQgkL 722  Heterostelium...
XP_004366105  645 MEYIFYPLGLYNDTAHRALQSLNQRFLYDEIEAELNLCFDQLLYKLSGKIFAHFKTQACSLLLDKNYKAQLELVHFAgkF 724  Cavenderia fa...
EAY21169      645 AELIFYPLAIYDDAANRARTKLASKMLMDEIMGEATICLSTLTTLISDFTFNAFRSYATMKYIPDNIQEGLKKTvdpdq- 723  Trichomonas v...
EAY03832      675 VGAIFYPLSIYDDAAATALKKLNSQYLFDEIRAEAEICVLSITKMICEFAFHNVRNYHTQAFSDQYNPNMLSEPTILnpT 754  Trichomonas v...
EAX87799      664 TGAIFYPLSIYDDAAATALKYLKSKYLFEEIRAEASICIQYLSREIAQQALNPILKFQLLQFMPKTVVSQLKESMLSldM 743  Trichomonas v...
3P8C_A        741 -PP------------SNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSLELAIGRFESEDLTSIVELDGLLEINRM 807 
ERN15716      381 ---------------SLRYDALLKMKRVKLLGRSVDLRSLIAQRMNKAFRKNIAFLFDRFDSQDICAVVELQQLLDVLRL 445  Amborella tri...
KRG97079      747 ---------------PIRLNMLLKMTRVKLLGRMINLRSLITERMNKVFRENIEFLFDRFECQDLCAIVELEKLLDVLKH 811  soybean
XP_013628230  752 ---------------PVRFTALFKMTKVKILGRTINLRSLIAQRMNKTFRENLEFLFDRFESQDLCAVVELEKLIDILKH 816  Brassica oler...
EEF40433      426 ---------------PMRFTALFKMTRVKLLGRTINLRSLIAERMNKVFRENLEFLFDRFESQDLCAIVELEKLLDILKH 490  castor bean
EFA78321      723 nIP------------KSRFDVLLRQKHIMLLGRSVDLSGLLAQRQNTYLRQNIEYAISRYEASDLTSIVELETQLINIRL 790  Heterostelium...
XP_004366105  725 nVP------------KSRFDVVLRQKHITLLGRSIDLTALLAQRQNNFVRQNIDYAISRYEASDLTSVIELETQLNSIRL 792  Cavenderia fa...
EAY21169      724 ----------wpqnrSYRLITMIQQNSYYLHGQNLDLRSLITKVVDGYMCDSVESTVGLFDKYGIASGIAVTKTLDILND 793  Trichomonas v...
EAY03832      755 ---------------ARRFPAVLQQNQLFLLGNYLDIKAFFAQRLDELFVDQMQDALSQVRANGLLSMIVFTKTLDILKN 819  Trichomonas v...
EAX87799      744 kDEanqedflkedisSLRLGVILQQNTLSILGCPIDTKTLISDNLNELIHEKLKALVNILESYGLFFIPMFYRIIEILRR 823  Trichomonas v...
3P8C_A        808 THKLLSRYLT-LDGFDAMFREANHNVS--APYGRITLHVFWELNYDFLPNYCYNGSTNRFVRTV--LPFSQEFQRDKQPN 882 
ERN15716      446 THRLLSEYLT-IDPFTPILMEMQENVSlaSFSGRLASQVFTEMQNDLLPNFILCNTTQRFVRSPkmLHQ--PIQKSSVPQ 522  Amborella tri...
KRG97079      812 SHELLSRDLS-VDSFSLMLNEMQENISlvSFSSRLASQIWSEMHSDFLPNFILCNTTQRFIRSSrtV----PVQKPSVPS 886  soybean
XP_013628230  817 SHELLSQDLT-IDPFSLMLNEMQENISlvSFSSRLATQIWSEMQSDFLPNFILCNTTQRFVRSSkvP----PTQKPSVPS 891  Brassica oler...
EEF40433      491 THELLSEDLS-IDSFGLMLNEMQENISlvSFSSRLASQIWSEMQSDFLPNFVLCNTTQRFVRSSrvPLA--PVQKPSVPY 567  castor bean
EFA78321      791 TYRLLSQFLQ-LDPLESILNEVNESTSlvSYHGRIALHTIFEIMSDFAPNYTFNSITQRFIKAP--YLFTEEVQRESMPK 867  Heterostelium...
XP_004366105  793 TYKLLSEFFT-LDPFESMMNEVNESTSliSYHGRIAFHTIFELMTDLAPNYTFNSITQRFIKAP--YLFTEDIQRENMPK 869  Cavenderia fa...
EAY21169      794 TRRLLCEAGLtLMPFELMVKSALGISVpsSFHTRLMEGLKEDICHNIAYKCYMRSNPTRFFPDN--------------PG 859  Trichomonas v...
EAY03832      820 THQIFVEYDIpVTKWEELQSLVFQNSTpnSFNSLVLEELEEHLFETVIPSYILHTNPMRMIPS--------ESDRQKKPK 891  Trichomonas v...
EAX87799      824 THELLCSFGLiLNPFNDILRLALSTDNpsSLQSLLLNHVYSHIENILVPDCSFFSFPMRVLPKG---------EMNIKQG 894  Trichomonas v...
3P8C_A        883 AQPQYLHGSKALNLAYSSIYGSYRNFVGPPHFQVICRLLGYQG-------IAVVMEELLKVVKSLLQGTILQY------V 949 
ERN15716      523 GKPSFYCGSQELNVAYHSFAQLYSKFFGLPHIFAILKLLGSRS-------IPWLIRALLDLLTVKVN-SLESK------I 588  Amborella tri...
KRG97079      887 SKPSFYCGTQDLNSAHQSFARLHSGFFGTPHMFSIVRLLGSRS-------LPWLIRALLDHISNKIT-LLEPM------I 952  soybean
XP_013628230  892 AKPSFYCGTQDLNAAHQSFARLHSGFFGIPHLFSIVKLLGSRS-------LPWLIRALLDHISNKIT-TLEPM------I 957  Brassica oler...
EEF40433      568 AKPNFYCGTQELNSAHQSFARLHSGFFGNPHMFSVVRLLGSRS-------LPWLIRALLDHISNKLT-ALEPM------I 633  castor bean
EFA78321      868 TNPLFLFGNKQLNAAYANSAELHKSFLGMPHMHALINVVGRKN-------LPLIIGECLRNIEIKINNVLTPY------C 934  Heterostelium...
XP_004366105  870 TNPVYLFGNKHLNAAYANSAELYKHFVGAPHIHSLLRVVGKKN-------LPLIIFECLRNMEVKIVSVLTPY------V 936  Cavenderia fa...
EAY21169      860 VPGSASFGKGNLGKILRDALLPTFSVITNEHFSVIIRLLDSGT-------IAQLLKDIQADFSKKIERFVELYnkqapkL 932  Trichomonas v...
EAY03832      892 I----------------AVLTQTTAFISVEHFRELVYILDDGG-------VYALSQALCEYAVSAFQAFSKAYksmhtnV 948  Trichomonas v...
EAX87799      895 IEQI---FTKDIASLFNAYLLKTTRIISIESVKDLFWMIEDGAgqvfsllFATLLEELEK-------PFVKIYdnvrknL 964  Trichomonas v...
3P8C_A        950 KTLME-VMPKICRLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNAILFCLLIEQSLSLEEVCDLLHAAPF 1028
ERN15716      589 MVLQE-SFPKSIGLVPFDGGVAGSLRVIHEQLH-WASTSEFKVEILHCLKEIGSILFCMGLFDIVLREVETTQFLQIAPW 666  Amborella tri...
KRG97079      953 TGLQD-SLPKSIGLLPFDGGVTGCVRLVKEHLN-WETKSELKAEVLHGIKEIGSVLYWMGLLDIVLREKDSMDFMQTAPW 1030 soybean
XP_013628230  958 SGLQE-ALPKSIGLLSFDGGVAGCMRLIREQLN-WGTKAELKTEVLRGIKEIGSVIYTMGLLDIVLREVDTKRFMQTAPW 1035 Brassica oler...
EEF40433      634 MGLQE-ALPKSIGLLPFDGGVPGCMRLVKENLN-WGTKSELKAEVLRGIKEIGSVLYWMGLLDIVLREVDTKHFMQTAPW 711  castor bean
EFA78321      935 RELIQsGMPPSQKLPIYDYGTEGGYGYFQLKLKDIYTYPDLRPEVIQCFRELGNSIVFMNLLDQALVQSDALIFTKSAPF 1014 Heterostelium...
XP_004366105  937 RELISsGMPASQKLPIYDYGTEGCYGYFQLKLRDIYTYPDLRPQVIQCFRELGNSIIFMNLLDQQMVQSECSSFIQAAPF 1016 Cavenderia fa...
EAY21169      933 QRFKD---------EPMNTPSTLVFDRFEGAYRFFAEDTEIE-KLFKAMKALGNIMSIASMLDISIAVKKLTKMHIAGFL 1002 Trichomonas v...
EAY03832      949 RRITD---------VPIGTGCHGVYDIFEGAYRGFVNDPSIE-QLLELMKVLGNTIAVAQMLDVGYSLKRNETQQILAYL 1018 Trichomonas v...
EAX87799      965 TRIAN---------PPASATFAQAFDVFEGAYHYFIDNQEIR-NCLSLMNQIGNVLMLAQLFDNALILKRTTGTLSSSFI 1034 Trichomonas v...
3P8C_A       1029 Q-----NILPRVHvkEGERL-----------DAK-------MKRLESKYAPLHl-VPLIERLG-TPQQIAIAREGDLLTK 1083
ERN15716      667 L-----GLVPGN---EGQVQ-----------QDLkengnspIISLFKSATTVIatLPSCPSPSsFLTMSKQAEAADVFYK 727  Amborella tri...
KRG97079     1031 L-----GLLPGA---DGQIV-----------TSqdgg-dspVVSLFKSTAAAMvsYPGCPSPTsFHIMSKQAEAADLLYK 1090 soybean
XP_013628230 1036 L-----GLIPGA---EGQIV-----------NAqeg--espLVNLLKSATSAVvsSPGCLNPAaFYTMSKQAEAADLLYK 1094 Brassica oler...
EEF40433      712 L-----GLVPAA---DGQIL-----------HSqdgg-dspLVNLFKSSITAMvsNPGCPNPStFFTMSKQAEAADLLYK 771  castor bean
EFA78321     1015 L-----GFTPESW--YQDPT-----------GEDptlqsplYSQLQKLAQLIEqkPDVTKVPEyFNEIVGNAWRADKFYR 1076 Heterostelium...
XP_004366105 1017 L-----GVTPDTW--YSDNT-----------GTDpttqsplYAQLAKLAQILEskPEVTKAPEyFKEIVNNAWRADKFYR 1078 Cavenderia fa...
EAY21169     1003 RgssidGK-------EYNDEif-------nfLPEgsvasdaIKRLDERVTGKDvhPPFISALI--RQIYDTSEKTGIFD- 1065 Trichomonas v...
EAY03832     1019 NgtdikNV-------DNKNDdff-----nlfDDRfkqlkkyFTGAEVVPSDQEitQPFMQKIV-EALAKEYLAQGDLFN- 1084 Trichomonas v...
EAX87799     1035 Lstd---------pvDNNEKmpetpevfelfDKTfqsskpyFSYLGNKIGDNEilLPFLSSCV-RELVTLLLHDYALFA- 1103 Trichomonas v...
3P8C_A       1084 ERLCCGLSMFEVILTRIRSFLd--dPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCIP----VGTHEFT-------VE 1150
ERN15716      728 NNLHSG-SVLEYSLAYTSAALdrlrSKWSS-NPKTGFIDITTSKDFYRIYGGLQFVCMEE----SLQDASR-------KH 794  Amborella tri...
KRG97079     1091 ANLNTG-SVLEYALAFASAALdkycNKWSA-APKTGFIDITISKDFYRIYSGLQIGYLEE----SAQVPSN-------SH 1157 soybean
XP_013628230 1095 ANMNGG-SVLEYTLAFTSASLdkycSKWSA-PPKTGFVDITTSKDFYRIYGGLQIGYLEE----ITVPQSG-------QQ 1161 Brassica oler...
EEF40433      772 ANLNTG-SVLEYALAFTSAALdkycTKWSA-APKTGFIDITTSKDFYRIYSGLQIGYLEE----SDKQSFN-------NH 838  castor bean
EFA78321     1077 PAD-NNTSLFKSVLQRISQILnnvrSEWSGTAPDNGVINVDSSTEFYRLWSALQFVTCWPl---TNENDKS-------YQ 1145 Heterostelium...
XP_004366105 1079 PTG-ANPSIFKNVLQRITQILnsvrAEWSGLTPDNGVINIDTSTEFYRLWSALQFVTCWPl---TNENDKS-------YH 1147 Cavenderia fa...
EAY21169     1066 -------------------------------ERAINYLMFETLTGFARAWSVLEFVFCIN----CVDNKMGss---lsPL 1107 Trichomonas v...
EAY03832     1085 -------------------------------ETSPNIFDFPSMTGFAATWSVLQFVFCLKeihsTEDAELSakkvrhgAF 1133 Trichomonas v...
EAX87799     1104 -------------------------------ETSPNLCDVKSQKGFAAIFSVLEFI---------ANNVVImdsskggGF 1143 Trichomonas v...
3P8C_A       1151 QCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDG------------KDEIIKNV-PLKKMVERIRKFQILNDE 1217
ERN15716      795 ECLGDSVAWGGCSIIYLLGQQLHFELFDFSYQLLNVAEVENtssgqsmssdrtKNTHYP-Q-GWENLIEGAKKVRRLNNH 872  Amborella tri...
KRG97079     1158 ERLGDSIAWGGCTIIYLLGQQLHFELFDFSYQILNIAEVEAasvm-----qthKNSQFAVQ-GWEALLEAMKKARRLNNH 1231 soybean
XP_013628230 1162 EVLGDSIAWGGCTIIYLLGQQLHFELFDFSYQVLNVSEVETvsas-----hthRNPQVL-Q-GWEGLLEGMKKARRLNNH 1234 Brassica oler...
EEF40433      839 EVLGDSVAWGGCTIIYLLGQQLHFELFDFSYQVLNVAEVEAgsls-----qmhRNPHLS-Q-GWESLLEAMKKARRLNNH 911  castor bean
EFA78321     1146 ELFGDGYMWAGCTFIHFLGQQCRFELFDFCYHILNVEEAA---------------AVRSDKpALKNFFKTAQFVKDMNQQ 1210 Heterostelium...
XP_004366105 1148 ELFGDGFMWAGCTIIHFLGQQNRFELFDFCYHILNVEDAA---------------AVRSDKpALKNFFKTASFMKDMNSQ 1212 Cavenderia fa...
EAY21169     1108 QVYGEGVMFIAGAIIAIIEQENIHFATDIGRRIMRVKGLDF--------------ASANND-RLARFCSLYELESSSLHW 1172 Trichomonas v...
EAY03832     1134 AMYGEGVFLSAGALLTLTRQRSLSKVLSIGERINQQNMTDI--------------AVIEDD-MISHFLAINRLVEASLQF 1198 Trichomonas v...
EAX87799     1144 AKFVEGIYYFAAVVLHMTNQRRLFRALSIGEKLISHFTADL--------------GVNVDD-RTNKFVAATKYFSTSLSS 1208 Trichomonas v...
3P8C_A       1218 IITIL 1222
ERN15716      873 VFSml 877  Amborella trichopoda
KRG97079     1232 VFSML 1236 soybean
XP_013628230 1235 VFsml 1239 Brassica oleracea var. oleracea
EEF40433      912 VFSML 916  castor bean
EFA78321     1211 IFSIL 1215 Heterostelium album PN500
XP_004366105 1213 IFSIL 1217 Cavenderia fasciculata
EAY21169     1173 AISVI 1177 Trichomonas vaginalis G3
EAY03832     1199 ALMAL 1203 Trichomonas vaginalis G3
EAX87799     1209 AFATL 1213 Trichomonas vaginalis G3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap