Conserved Protein Domain Family
DUF899

?
pfam05988: DUF899 
Bacterial protein of unknown function (DUF899)
This family consists of several uncharacterized bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 399171
Aligned: 35 rows
Threshold Bit Score: 244.522
Threshold Setting Gi: 123167300
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q0K304          1 MTTHSTGTREAWLAARRELLEAEKDLTRRSDELARQRQALPW-VRIDKP--YRFETAAGSASLADLFQGRSQLLVYHFMF 77  Cupriavidus ne...
Q2JCJ9         13 PGRPPVVDLTAWQTARDELLVREKAHTREGDALAAARRRLPM-VELDGT--VEVVGPDGPVPFLDLFQGRDELVVYKHMW 89  Frankia casuar...
jgi:Haur_1510  17 SAMPNIVDRANFQATVDRLRSREKAHTREADAIAAERRRLPM-VELDPL--TPLVGKNGTVPLIEAFEGRQQLMVAYMMW 93  Herpetosiphon ...
jgi:Haur_4695  17 PSLPAAVDRATFQAELNSLRVREKAHTREGDAIAAARRRLPM-VEVAAT--TLVVGPNGLVPLIEVFEGRKQLFAAYMMW 93  Herpetosiphon ...
Q8CV44          7 PTLPQIVSRDEWLEARKELLYKEKEFTKERDELNAERRRLPM-VEIDKE--YVLDGPHGKTRLLDLFEGRPQLIVHHFMF 83  Oceanobacillus...
Q0SAW4          3 ASDPQVTTREEWLIARRELLAQEKELTRHRDRVNAARRALPM-VEITEN--YVFDGPDGRTGLADLFDGRSQLLIYHFMF 79  Rhodococcus jo...
Q2UHW8          3 PPSQNIVSPTEFQKAHSTHLAHEKAATHHLQALASARRSLPI-VPVPDAsrFKFDTIDGEKTLPELFAGRKQLIMYHFML 81  Aspergillus or...
Q13LN8         21 psrFP-GESAEYRRARNDLLVEEIELRRHIERVAAQRRALPAgGVVPED--YRFMGEAGPVALSEMFGAHDTLVTYNWMF 97  Paraburkholder...
Q0K3L7         18 PVRFP-NESAEYRKARNALLAEEIELRRHIERVAEQRRGLPAgGEVTKR--YTFQGERGPVTLAELFGDKDTLVIYSYMF 94  Cupriavidus ne...
WP_012404695   18 GSHFP-NESVEYRRARDALLAEEIELRRHIERVAEQRRRLPPgGEVTGD--YRFVGEAGSVDFAGLFGDKATLVIYSFMF 94  Paraburkholder...
Q0K304         78 --GPDYQAGCPSCSAIADGFDGFVVHLAHHDVTLAAVSRAPLAKLQAYQRRMGWT-FPWASSQGSDFNTDFNVWFSEAQQ 154 Cupriavidus ne...
Q2JCJ9         90 ydGAPHQGQCEGCTTTAWHL-KDAVYLNARGVSFAILTTGRWDEVASYVEFMGYT-QPWYSVR--DVDGPVG-------- 157 Frankia casuar...
jgi:Haur_1510  94 heGKTAAEQCPGCTMVISHA-NQLGYLHTRDVTLAVLCQGPFEPSNRYREFMGWT-MPWYSVPEASVETLIA-------- 163 Herpetosiphon ...
jgi:Haur_4695  94 hhGANAAQQCEGCTMNVGHV-LELGYLHSRDVTFAVLSQGPFAESNRYREFMGWE-LPWYSVPESSLDALIA-------- 163 Herpetosiphon ...
Q8CV44         84 --DPEWDAGCPACSLAADNM-GYLSHLHARNTSLALVSRATLPKLQRYKERMGWN-IPWYSSYDSDFNYDFHATLDESVA 159 Oceanobacillus...
Q0SAW4         80 --EPDADEGCPSCSFTMDNV-GDLRHLYARDTSFAAVSRAPLPKLEQYRRRMGWM-FPWYSSHGSDFNYDYHVTLDASVA 155 Rhodococcus jo...
Q2UHW8         82 --GPEDEKGCVGCSFCMDHI-PDLRHLESRDTSFVAVARAPVGKIEEYKRLTGWG-FPFYSSE------KTHRAWEEAEK 151 Aspergillus or...
Q13LN8         98 --GPQRVRPCPMCTSLLSAYDGEMPDILQR-VAFAVIARAPIERLVAFGKERGWRhLRLYSSGGNSFNRDYAAEDPAG-- 172 Paraburkholder...
Q0K3L7         95 --GPQREQPCPMCTSVMASWDHKVPDIEQR-VALAMIARSPIDRLVAAKKARGWTkLKVYADVDGDFTRDYVSPED---- 167 Cupriavidus ne...
WP_012404695   95 --GPQRERPCPMCTSLLGAWDGEARDITQR-IALAVVARSPIERLVAFKEERGWRaLKLYSDVNGVYSRDFGAINDDG-- 169 Paraburkholder...
Q0K304        155 RQGDidynyrreaafawrpeleaggaaaeaqfaamcgtDAATYQRDRPGM-SAFALED-GVVYHTYST-----------Y 221 Cupriavidus ne...
Q2JCJ9        158 --------------------------------------------GSMGYI-TCFLRDG-DRVFLTYST-----------T 180 Frankia casuar...
jgi:Haur_1510 164 --------------------------------------------GRHFGMwACYLRKG-DRVFETYWT-----------T 187 Herpetosiphon ...
jgi:Haur_4695 164 --------------------------------------------DRHFGI-WVCYVQDnGRVFETYWT-----------T 187 Herpetosiphon ...
Q8CV44        160 PIEYnyltkde--------------------lvqkgvpVDSGQSMEVPGV-STFLRDG-ERIFHTYTT-----------Y 206 Oceanobacillus...
Q0SAW4        156 PVEYnykdeae---------------------lvrldpAWEGWCGEEHGV-SAFLRQG-ERIFHTYSG-----------Y 201 Rhodococcus jo...
Q2UHW8        152 GGEV----------------------------------ITWKPGNGYFGL-CVFFRGDeGEVFHTYST-----------T 185 Aspergillus or...
Q13LN8        173 --------------------------------------------DDHPAF-NVFTRSG-GTVRHFWAEemgpstadpgqD 206 Paraburkholder...
Q0K3L7        168 --------------------------------------------ADAPGY-SVFTRRD-GKIRHFWSSemyalsvdpgqD 201 Cupriavidus ne...
WP_012404695  170 --------------------------------------------GDDPAF-HVFTRRD-GTIRHFYASemgfatadpgqD 203 Paraburkholder...
Q0K304        222 ARGLDGLWGMYQWLDRAPRGRNEA-------------GVWWRRHD-------E---Y 255 Cupriavidus necator H16
Q2JCJ9        181 GRGNEPVNGSLGLLDMTPYGRGEAwednpeawpegrsSCWFWRSD-------A---D 227 Frankia casuarinae
jgi:Haur_1510 188 DRGCELMGSSFAMLDMTVYGRQEVwqq--------vpAGWPQPFDntm-clpNtlqN 235 Herpetosiphon aurantiacus DSM 785
jgi:Haur_4695 188 GRGCEQMGSSYAMLDMTIYGRQEAwed--------spAGWPQRFFntrsaqmRtdeH 236 Herpetosiphon aurantiacus DSM 785
Q8CV44        207 ARGTDLILGTFNYLDLTALGRQEDweqppg-rsdgrgKTWLRRHD-------E---Y 252 Oceanobacillus iheyensis
Q0SAW4        202 ARSTEILLGTYHWLDLTARGRQEDwepepr-rgddpfMSWLRRHD-------E---Y 247 Rhodococcus jostii RHA1
Q2UHW8        186 DRGMEILLGTYHLLDMTPLGRQEVgn----------gMNNFRRIY-------E---Y 222 Aspergillus oryzae
Q13LN8        207 PRGAPDVMPIWTVLDMTPGGRGTD---------------WYPKLEydtapg------ 242 Paraburkholderia xenovorans LB400
Q0K3L7        202 PRGAPDLDPLWTLLDTTPEGRGAD---------------WYPKLE-----------Y 232 Cupriavidus necator H16
WP_012404695  204 PRGAPDLMPMWTIFDMTPEGRDPH---------------WYPKLD-----------Y 234 Paraburkholderia phymatum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap