Conserved Protein Domain Family
DUF898

?
pfam05987: DUF898 
Bacterial protein of unknown function (DUF898)
This family consists of several bacterial proteins of unknown function. Some of the family members are described as putative membrane proteins.
Statistics
?
PSSM-Id: 399170
Aligned: 61 rows
Threshold Bit Score: 202.057
Threshold Setting Gi: 501563830
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8Y1P7             21 PLRVRFCGSGSEYFRIWIVNLLLTIVTLGIYSAWAKVRTLQYFYRNTQLGGASFDYHGSPTAILKGRAIIFVLALAFN-- 98  Ralstonia ...
WP_012568293       30 dGAVRFEAERGTLIGLLLTNMLLNLLTLGLYRFWARTRVRRFFWGALRIDGRPLDYTGRGMELFLGFMVALVVLAPVLag 109 Rhodospiri...
Q89E46             71 PTRVDFAGDRSVFRKMVTKGAMLELVTFGFYRFWLVTDIRRHLWSNTSIDGDAAEYTGRGKELLIGFLFALAILVPIY-- 148 Bradyrhizo...
jgi:Mrad2831_3236  20 VAAVTFDPRVEGLTWLALKGFLLSVVTFGIYRFWYVTNLRRFFWERTALDGSPAEYTGTGKELFLGFLVALAILVPIYva 99  Methylobac...
jgi:Caul_3400      12 TLTFSQKIKSGDFVGLSFKNFLLNMVTLSLYRFWAKTEVRRRIWDKVSLNGEPFEYTGTGKELFFGFLKAMVVIFVPY-- 89  Caulobacte...
CDK97730            3 eSAFVHHGRLGAVIRLSVVNALLNIVTLSLWRFWGKTRVRAYLWGHTTIWGEPLEYVGRGGELFIGFLLAMLVVFTPYmi 82  Magnetospi...
Q2W2Q0              8 QRPLVCSGDVGNMISTALSNMLLSILTLSIYRFWGKTNVRRQLWSATRAWGDPLEYTGTGKELFIGFLIVLVIVYLPLva 87  Magnetospi...
Q30VJ4             28 aPFLAFTGTGKSLFFLYIINGLLTVLTLGIYSFWGTTKIRRYFWSHTKVQGEPLEYTGTGGQLFVGFLIGIVLLGLLAli 107 Desulfovib...
Q0BSQ4             24 RPFFQYDGKTGELYKIFLINLLLSIVTLGIYRFWAISRMRRYLWSRCRFQETRFTYTGTGGELFLGFLKVLGLLILLIaa 103 Granulibac...
WP_013246913        1 mrRGSFHGTGGTLLGMQIVNVCLTILTLGAYHFWAKAKIRRYLFSQTAFAGDRFVYHGTGKELYQGFLKAMLVFGIPYfs 80  Nitrospira...
Q8Y1P7             99 ---------LSGQVS--------PVLTLLLLAAIGLVFPWLL---VRSLRFRMANSSYRGLRFAFTGKDAQAYKVFLLWP 158 Ralstonia ...
WP_012568293      110 fqfvanvltVTHPVA----------GVTLTLLFYPLLGALALtgtYFARRYLLTRTRWSGIAAGQDGTVARFVGQHLWAY 179 Rhodospiri...
Q89E46            149 ---------LAYFLIgieferwqGFASTPLFISFYAFGQFAI---FRARRYRLTRTVWRGVRFWMDGSGWAYSFRAMLWG 216 Bradyrhizo...
jgi:Mrad2831_3236 100 lfavslvapALAPF-----------SVVISFVFLFLLGQFAI---YRGRRYRAMRTLWRGIRLGQDGSGLAYAARAGAWW 165 Methylobac...
jgi:Caul_3400      90 ---------LTVLLAtqfvskwfMILFLPMYIALFVLLGAAI---FMAFRYVAGRTTWRGVRFRVKGSASDYGWAYLGYG 157 Caulobacte...
CDK97730           83 lvtvaqlmlVEENPLg-------ALLFALAQFSLFFLIGVGL---YRARRYLMTRTVWRGLRAGQDGSALTYALLILGHI 152 Magnetospi...
Q2W2Q0             88 gfasaqvllVSGNPLg-------ALLLSGLYLLTILLVSVGL---YRARRYQMSRTLWRGIRGGQTGSGWGYALRSLAVW 157 Magnetospi...
Q30VJ4            108 al---atdmLFGPPA----------GTLTGILIALLFAPYAI---FRSMRFRLAHTRLHGIPFGLEGSPVRFAGRTLLRS 171 Desulfovib...
Q0BSQ4            104 tgaaayglaKLSPSL----------VPVPIVAAYIFVVLLAVgapYAAQRYRLSRTEWNGIRGGMTGSLFTYAFYALLYG 173 Granulibac...
WP_013246913       81 lgaahsflaLPQAVD--------VLLQAMAALVLFLYVPVAI---VNARRYRCTRTSWRGIRFSFRGRTADFLKLYFKGW 149 Nitrospira...
Q8Y1P7            159 VLTVFTFNLLAPFAHQRFKQYQHRNTRFGTTSFDFSATAG-QFYGVYLRTFGMAILAVMAVGVVVVLAGVSAAAGAASGG 237 Ralstonia ...
WP_012568293      180 LLATLSLGIAMPWADANTYRYRMSITRFGTGRFGSDADSR-GLWGAWLAAWGLLALGTVLWFVGFMPALQTVEEHQAGVP 258 Rhodospiri...
Q89E46            217 LLVFLTLGLALPWREASLERYKMQHTHYGDLSGDFEGDGW-TFFKRGWW------------------------------- 264 Bradyrhizo...
jgi:Mrad2831_3236 166 LLTLVTVGLAVPFMRASLERYRIGHTLVGTSRMHSTARGR-SVLGPWLLLYVVGLGPLIGLGIALLAAADFSLPGDLLVP 244 Methylobac...
jgi:Caul_3400     158 LLTSITFGWFAPAMTMRLEGKLWSSLSFGDKKLTWQREANeNLYGPFALAWIVGIVGYGVFIALLMPSFMGGLRPNGVPD 237 Caulobacte...
CDK97730          153 VLMGLTLGWSAPWMSVKIERYRLNHTRFGDTGFTCDATSG-SLYKRFSAVW-FSFIPVVACMALLGAFMDYPNPETMEPG 230 Magnetospi...
Q2W2Q0            158 MAVPLSLGWALPWGEMWLASYRLNNTTFGDRRFTCDATAS-GLYGRFTLVWFSGLIFAVAAIAAAAGASSLVGESEEDQA 236 Magnetospi...
Q30VJ4            172 FIALVTLGLMIPWAYAKVTADILGNIRYGDKMFTFTGKPM-ALVKAAILPMLLVIVPMAAYVGFLVMLASGSLAGYSSSE 250 Desulfovib...
Q0BSQ4            174 VLTILTLYQLAPWAAVRLTEYRINNSQFGSEKLSFYGRAG-RLYLAFLATFLIMVVLFFSIALLTWYVLAVTFGADPWVF 252 Granulibac...
WP_013246913      150 LFTLLTLGTYYPYFQTERQAFLHSHTYFGNQRFQFTGHGS-GLMVPFAVTLFTTYAVLCLCGLALALQ------------ 216 Nitrospira...
Q8Y1P7            238 r-----------------------------AIAVSLMVLAMYAAMLFLGPYFLARLQNVVWNHTTLGAHRFQSQVSAGKL 288 Ralstonia ...
WP_012568293      259 ptp------------------------vdlNDMLLTVAVLSYAAGLLGLAFYRLVRFRHFTRHTWLEGIRFRCDAPARAF 314 Rhodospiri...
Q89E46            265 ------------------------------LWLLSPIALVIFPLAPFFYAEFKAREWRWWLDGIRIGGVSLSSELPHNAF 314 Bradyrhizo...
jgi:Mrad2831_3236 245 kpggkagetiln-------payaashigvlLRTMGFAAAICVPAALLLIPYYRARETRAFMAAAGLGHARLASSLKARQF 317 Methylobac...
jgi:Caul_3400     238 va--------------------------lfFKIYGYALVYA-LVVTVASAAYHAAVMRAVVAAIRIDDARFSTSVKALDL 290 Caulobacte...
CDK97730          231 eff------------------------aklALVYVWLFGSTLVFTALPLAAYNAAYWRQIAAHTRFDGIGFSFELGAWRL 286 Magnetospi...
Q2W2Q0            237 aa---------------------------gIGFAMLLVPVAVVTMALPLAWYRAGFYRNLAAGTEFEGSRFSADTRAWRL 289 Magnetospi...
Q30VJ4            251 l-----------------------------RTLILIIASALGLLTFISSLLWQCRFIRWAATGMHFGEAGLTCSITPLRL 301 Desulfovib...
Q0BSQ4            253 sdngrslvtlfkalphfepeiaknvqtiiaLVGVGALFIYL-ILATLISCWYIALFIRHVIGNTTYASFRFFSTVTGLKL 331 Granulibac...
WP_013246913      217 ------------------------------LTNAGLTLLLIPFVLGPVWVWLLGQKQKYYWDHTTFGKARFSSSITWQKL 266 Nitrospira...
Q8Y1P7            289 FWIF---ISNAALL----------------------------------------IVTLGLF------------------- 306 Ralstonia ...
WP_012568293      315 IGVI---AVTALLLlavaglaalagigiamlipspagvvvggavalllllaatpLVTTGYY------------------- 372 Rhodospiri...
Q89E46            315 YGLYwkvIGWWMLLsiifaaylggatmlvvklsglpveqvfgpdntaksipmlaMMVIGYFalala-------------- 380 Bradyrhizo...
jgi:Mrad2831_3236 318 YWPY---IVYMLSLlg-------------------------------------fLVVLGLVaallifaaraagdlgtlhg 357 Methylobac...
jgi:Caul_3400     291 IVLS---LTNALIV----------------------------------------VFSLGIL------------------- 308 Caulobacte...
CDK97730          287 VRLF---VGNALIT----------------------------------------ALSLGIL------------------- 304 Magnetospi...
Q2W2Q0            290 IGLV---MGNMLIS----------------------------------------LFSFGIL------------------- 307 Magnetospi...
Q30VJ4            302 FVAL---LKFMLIT----------------------------------------LFTLGIG------------------- 319 Desulfovib...
Q0BSQ4            332 LGQL---TGNFLIT----------------------------------------LFTLGLG------------------- 349 Granulibac...
WP_013246913      267 FGLY---LGNLALL----------------------------------------LLTLGWA------------------- 284 Nitrospira...
Q8Y1P7            307 -----------------TPFARVRSARYKLESVTMLAAGSLDTFVAGE-STRvgal--gdaAVDW 351 Ralstonia solanacearum
WP_012568293      373 -----------------LPALLTR----LAAHGRITDLSAADAIV----NRAtpaprrgegLIDA 412 Rhodospirillum centenum
Q89E46            381 ------------iniimRVYLQRDLWAKVLETVEVHNIGAAADVR----GSGelasalgegFADG 429 Bradyrhizobium japonicum
jgi:Mrad2831_3236 358 lvvliylvgaplfavlyVRVVQARLWAAVATSTTVVDPRALDSVLASS-RGAgsgl--qegLADA 419 Methylobacterium radiotol...
jgi:Caul_3400     309 -----------------TPVVAARTVRFVISRLSSTGTVNLAEVL--Q-APRsagg--degLADA 351 Caulobacter sp. K31
CDK97730          305 -----------------RPVASMRTLRTACQCLSMESQPDLSRLF-AG-TQPiprt--gegLLAA 348 Magnetospirillum gryphisw...
Q2W2Q0            308 -----------------RPWASLRTFRYACSVIGVEGEPDFARVH-RA-EDTgpst--gegLVAV 351 Magnetospirillum magnetic...
Q30VJ4            320 -----------------LPWAIVGLQRFFMQLYEPTGDIVFADVHRGPeQHEatg----dgIAQA 363 Desulfovibrio alaskensis G20
Q0BSQ4            350 -----------------LPFVIQRNMRFLERHTLVIGNPLPAEWLHQN-TQSlpat--gegLLNV 394 Granulibacter bethesdensi...
WP_013246913      285 -----------------WPWVTVRNARFFTGTLSLQGVTDLDRVL-QD-TTEtsvt--gegLSNL 328 Nitrospira defluvii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap